(data stored in ACNUC7421 zone)

EMBL: CP000094.PE271

CP000094.PE271       Location/Qualifiers
FT   CDS_pept        complement(318988..319269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72017"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJN9"
FT                   /protein_id="ABA72017.1"
FT                   /translation="MNMYTPLNTRFLPLKTCESDKPVLVIDTEAEPGDLLNAADQRLRA
FT                   ASDLLETLYCVCFKQADVKDIPNIVNALYLLTQDGCDLLKVARQRINN"
     atgaatatgt acacaccgct gaatacccgt tttctccctc tcaagacttg cgaaagcgac        60
     aagccggtat tggttatcga caccgaggca gaaccgggcg acctgctcaa tgccgccgat       120
     caacgcctgc gtgccgccag cgatctgctg gaaactcttt actgcgtatg tttcaaacag       180
     gccgatgtga aagacatccc caacatcgtt aacgcgcttt atttgttgac gcaagacggt       240
     tgtgacttgc tgaaagttgc cagacaacga ataaataact ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page