(data stored in ACNUC7421 zone)

EMBL: CP000094.PE276

CP000094.PE276       Location/Qualifiers
FT   CDS_pept        complement(324239..324718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0278"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72022"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJN4"
FT                   /protein_id="ABA72022.1"
FT                   /translation="MKFSSILLLSLGLVSGFASAGGTTEAGVGGALGGVLGSVVGQSLG
FT                   GSTGSTIGAALGGAGGSAVGADKRSRGEAAIGGALGAAGGNVVGRSMGGTTGSLIGAAA
FT                   GGGAGGALGNYMGNKSDDDDRHYDRRHDDRRYYRDRHPGRGHAYGHRKHHRYYRD"
     atgaagttct cctcgattct cttgttgtcc cttggcctgg tcagtggctt cgcttctgcc        60
     ggaggcacca ccgaagcagg tgtgggcggc gcattgggcg gggttcttgg ctcggtcgtc       120
     ggtcaatcct taggcggcag tacaggttca accattggcg cggccctggg cggcgcgggt       180
     ggtagtgcgg tgggcgccga caagcgcagc cgtggcgaag cagccatcgg cggtgcgctg       240
     ggcgcagccg gcggcaacgt ggtcggccgc agcatgggcg gcaccaccgg cagcctgatc       300
     ggcgcagcag ccggtggcgg cgcgggtggc gcgctgggca actacatggg caacaagagc       360
     gatgacgatg atcgtcatta cgatcgtcgc catgatgatc gtcgctacta ccgtgaccgt       420
     cacccaggtc gtggccatgc ctatggccat cgcaagcacc accgctacta tcgcgactga       480
//

If you have problems or comments...

PBIL Back to PBIL home page