(data stored in ACNUC7421 zone)

EMBL: CP000094.PE278

CP000094.PE278       Location/Qualifiers
FT   CDS_pept        complement(327352..328191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72024"
FT                   /db_xref="GOA:Q3KJN2"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJN2"
FT                   /protein_id="ABA72024.1"
FT                   /translation="MNAKRPACAAPALETPAPAASQTYSYSDLPLAESASTALAEEVAL
FT                   AIAYNGISQAVMLVTPTDLEDFIVGFSLGSGIIEDASDIYDLQLSGSGSAQYAQVTIAN
FT                   RAFWNLKQQRRQLAGTSGCGLCGVEAVEQALPDLKVLPGAPLPPIEWLDGLRQRIGAFQ
FT                   PLGQHCGAVHAAVFMNASGELLLGREDIGRHNALDKLIGGLIRQKISTAGGLAIVTSRC
FT                   SLELIQKVLRAGIQTLVSLSAPTGLAVQWARRHNLNLIHLPQKNAPRVYSPEMEKHP"
     atgaacgcca agcgcccggc ctgcgcggcg cccgctctcg aaacacccgc gcctgccgcc        60
     agtcagacct acagctacag cgatctaccc ctcgcggaat cggccagcac cgcgctggcc       120
     gaagaagtcg cgttggcgat tgcctacaac ggcatcagcc aggccgtcat gctggtgacg       180
     ccgaccgacc ttgaagactt catcgtcggt ttcagcctcg gcagcggcat catcgaagac       240
     gcctcggaca tttacgatct gcaactgagc ggttcgggct cggcgcaata cgcgcaagtg       300
     accatcgcca accgcgcgtt ctggaacctc aagcaacagc gtcggcaact ggccggcacc       360
     agcggctgcg ggttgtgcgg cgtcgaagca gtggagcagg cgttgcctga tctcaaggtc       420
     ttgcccggcg cccccttgcc gcccatcgaa tggctcgacg gtttgcgtca gcgcatcggt       480
     gcttttcagc cactgggtca gcactgcggc gcggtgcacg cggcagtgtt catgaacgcc       540
     agcggtgaat tgctgctggg ccgcgaagac atcggccggc acaacgccct cgacaaactg       600
     atcggcggcc tgatccggca aaagatatcg acagccggtg gcctggcgat tgtcaccagc       660
     cgttgcagcc tcgaattgat ccagaaagtt ttgcgggccg ggattcagac cctggtcagc       720
     ctgtccgcgc ccaccggcct tgccgtgcaa tgggcccggc gccacaacct caatctcatc       780
     cacctgccgc agaaaaacgc gccgcgggtg tatagcccag aaatggagaa acacccgtga       840
//

If you have problems or comments...

PBIL Back to PBIL home page