(data stored in ACNUC7421 zone)

EMBL: CP000094.PE28

CP000094.PE28        Location/Qualifiers
FT   CDS_pept        complement(31102..31761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0028"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71772"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKD4"
FT                   /protein_id="ABA71772.1"
FT                   /translation="MKNAETPAVKVVLYGAMSSLGSALMAELLRRQHEVIAILDDLTAL
FT                   APRPGLRTKSGDLLDAERVNQSVAGSSAVICLLNAPGLPLSSDHVEKSVVLGPVEQVLA
FT                   VDALIDGLQAANVSRLFVIGEFEALDDPENADPLQRHAAQEVREALQSSPLHWTLVNAP
FT                   RSVAGLTIEHFSQVGRTLEPGLAEPLERLNRVAVGIADELRLNLHLRQHVDFVAAS"
     atgaaaaatg ccgaaacccc ggcggtgaaa gtggtgctct atggtgccat gagtagcctg        60
     ggcagtgcgt tgatggctga actgctgcgt cgccagcacg aagtcattgc catcctcgac       120
     gatctgacgg cgctcgcccc acggccgggg ctgcgcacca aaagcggcga tctgctcgat       180
     gccgagcggg tcaaccagag tgtcgccggc agctcggcag tgatctgcct gctcaatgcg       240
     ccgggcttgc cgctgagcag cgatcatgtc gagaaatccg tggtgttggg gcctgtggaa       300
     caggtgctgg cggtggatgc gctgatcgac ggactgcagg cggcgaacgt ctcgcggctg       360
     tttgtcatcg gcgaattcga agccctggac gatccggaaa acgccgaccc gttgcaacgc       420
     cacgccgctc aagaggttcg cgaagccctg caaagcagcc cgctgcactg gacgctggtg       480
     aatgcaccgc gcagcgtggc cgggctgacg atcgagcatt tcagtcaggt cggccgcacg       540
     cttgaaccgg gtctggccga accgctggag cgcctgaacc gggtggcggt gggcattgcc       600
     gatgagctgc ggctgaattt gcatctgcgc cagcacgtgg attttgtcgc cgcttcttga       660
//

If you have problems or comments...

PBIL Back to PBIL home page