(data stored in ACNUC7421 zone)

EMBL: CP000094.PE284

CP000094.PE284       Location/Qualifiers
FT   CDS_pept        complement(332029..332484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72030"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJM6"
FT                   /protein_id="ABA72030.1"
FT                   /translation="MKHDSRYLESVLHHDIPLTRDMGLKVLDWQEQQLRLHLPLDANVN
FT                   HKSTMFGGSLYCGAVLAGWGWLHLRLKEEGIEDGHIVIQEGQISYPLPVTGDAIAICPS
FT                   PSATQWKKFLAMYQRYGRARLTLHTRVVNAGSNEDAVTFSGQYVLHR"
     atgaagcacg acagccgtta tctggaatcc gtactccatc acgacatccc gctgacccgg        60
     gacatgggac tcaaagtgct cgactggcag gaacagcaac tgcgcctgca tctgccgctg       120
     gacgccaacg tcaatcacaa gagcaccatg ttcggcggca gcctgtattg cggtgcggtg       180
     ctggccggtt ggggctggct gcatttgcgt ttgaaagagg aaggcatcga agacgggcac       240
     atcgtgattc aggaaggaca gatcagttat ccactgcctg tgaccggcga tgccattgcg       300
     atctgcccgt caccgagtgc aacgcagtgg aagaaatttc tggcgatgta tcaacgttac       360
     ggacgggcgc gattgactct gcatacgcgg gtcgtcaatg ccggtagcaa tgaggatgca       420
     gtgaccttca gcgggcagta cgtcctgcac cgctga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page