(data stored in ACNUC7421 zone)

EMBL: CP000094.PE29

CP000094.PE29        Location/Qualifiers
FT   CDS_pept        31846..32172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71773"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="InterPro:IPR023389"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKD3"
FT                   /protein_id="ABA71773.1"
FT                   /translation="MQTIKGYHAHVYYDASTIKQARALCEQAAALFPLKMGRVHERPVG
FT                   PHPDWSCQLAFGPELIGDVLPWLALNRKGLVVFLHPDTGDDLLDHTEHAIWMGAMRPLD
FT                   LSVF"
     atgcagacga tcaagggtta tcacgcccac gtttattacg acgccagcac gatcaaacag        60
     gcgcgggcac tttgtgagca ggcagcagcg ctgtttccat tgaagatggg ccgcgtgcac       120
     gaacgcccgg tgggcccgca cccggactgg agctgccagc tggccttcgg cccggagctg       180
     atcggcgacg tgctgccgtg gctggcgctc aatcgcaaag ggttggtggt gttcctgcac       240
     ccggacaccg gcgatgactt gctcgatcac accgaacacg cgatctggat gggcgcgatg       300
     cggccgctgg atctgtctgt tttttaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page