(data stored in ACNUC7421 zone)

EMBL: CP000094.PE290

CP000094.PE290       Location/Qualifiers
FT   CDS_pept        340953..341207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72036"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJM0"
FT                   /protein_id="ABA72036.1"
FT                   /translation="MDNVAAHERGESAEMNAEVNVISERTLHPMAVNSESLQIVAHWLK
FT                   SNGTRQIREPDPRRMMIERYPAGLFSEAELEALWDVMEG"
     ttggataacg tagccgctca cgaacgggga gagagcgctg aaatgaacgc cgaagtgaac        60
     gtaatcagcg agcggacatt gcatcccatg gctgtaaata gtgagtcgct ccagattgtc       120
     gcgcactggt tgaaatccaa tggaacgcgt cagatcaggg aacctgatcc gcgccggatg       180
     atgatcgagc gttaccccgc tggcctgttc agcgaggccg aactggaagc actctgggat       240
     gtgatggaag gataa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page