(data stored in ACNUC7421 zone)

EMBL: CP000094.PE292

CP000094.PE292       Location/Qualifiers
FT   CDS_pept        343619..344287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72038"
FT                   /db_xref="GOA:Q3KJL8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJL8"
FT                   /protein_id="ABA72038.1"
FT                   /translation="MTLHYIYDPLCGWCYGAKPLVQAAQQVLPVIAHAGGMMTGANRQS
FT                   VSPQLRNYVMPHDRRIAEYTGQPFGEAYFEGLLRDQSALFDSAPPIAAVMAAEKIDGRG
FT                   LELLGRLQTAHYVEGRRIADESVLVEYAVEQGYNADMFLNALQSVDTEQHIKNSRALLA
FT                   KLGGQGFPTFALEQDGRFTLVDIGPWLGKPEAFAQWLSESFTPAPGTETLPVCGLDGCA
FT                   "
     atgacccttc attacatcta cgacccgctg tgcggctggt gctatggcgc caaaccactg        60
     gtgcaggccg cgcaacaagt gctgccggta atcgcccacg ccggcggcat gatgaccggt       120
     gccaaccgcc agagcgtttc gccgcaactg cgcaattacg tgatgcctca tgaccggcgc       180
     atcgctgaat acaccggtca gccattcggc gaagcttatt tcgaaggtct tttgcgtgat       240
     caatcggcgt tgtttgattc ggcacctccg attgccgctg tgatggcagc ggaaaaaatc       300
     gacggtcgtg gcctggaact gcttggccgt ttgcagactg cgcactatgt ggaagggcgg       360
     cgaattgccg atgaaagtgt gcttgtggaa tatgcagtag agcagggcta caacgccgat       420
     atgttcttga atgccttgca gtccgtcgac accgaacaac atataaagaa cagccgtgcc       480
     ctgttggcaa aactgggtgg gcagggtttt ccaacttttg cgctggaaca ggacggacga       540
     ttcacgctgg ttgatatcgg gccgtggctc ggcaaaccag aagccttcgc ccaatggttg       600
     agcgagtcgt ttacgcctgc gccagggact gaaaccctgc cggtctgtgg cctcgatggt       660
     tgcgcgtaa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page