(data stored in ACNUC7421 zone)

EMBL: CP000094.PE294

CP000094.PE294       Location/Qualifiers
FT   CDS_pept        346106..346852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72040"
FT                   /db_xref="InterPro:IPR018724"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJL6"
FT                   /protein_id="ABA72040.1"
FT                   /translation="MIVLTREVGESLRRDKYANVQGADFNLYGHFADFVRLTKSWENME
FT                   PDSYYGQAEAGMRYRRYSDFEYNPKTRELKQLEHRAYVQSKANNSYVGGVVRHFQDFSD
FT                   EVISSPVMRSLIDTDFEVYKSVLPEELHDEIWQCQIHQIRIEIKPGKQLEITPEGIHCD
FT                   GYPFSGVHFWGRNNVEGAESRLYDIHEQQLASTTYQEILDTTYFLDRDMRHYVTPARNT
FT                   HSHAMAYRQILAISFSRPGTAFDIVR"
     atgatcgttt taaccagaga agtgggcgaa tcgctacggc gcgacaagta cgccaatgtg        60
     cagggtgctg acttcaatct ctacggtcat ttcgccgact tcgtcagact gaccaaaagt       120
     tgggaaaaca tggagcctga cagttactac ggtcaggccg aagccggcat gcgttaccgt       180
     cgttacagcg actttgagta caaccccaag actcgcgaac tgaagcaact ggaacatcgc       240
     gcgtacgtgc agtccaaggc caacaacagc tatgtgggcg gggtggtgcg gcacttccag       300
     gacttctcgg acgaagtcat cagctcgccg gtgatgcgca gcctgatcga caccgatttc       360
     gaagtgtaca aaagcgtgtt gccggaagag ctgcacgatg aaatctggca gtgccagatc       420
     catcagatcc gcatcgagat caagcccggc aaacaactgg aaatcactcc ggaagggatt       480
     cactgcgacg gttacccgtt cagcggcgtg cacttctggg ggcgcaataa cgtcgagggc       540
     gcggagagtc gtctgtacga catccacgag cagcaactgg cgtcgaccac ttaccaggaa       600
     atcctcgaca ccacctactt cctcgaccgt gacatgcgtc actacgtgac accggcacgc       660
     aacactcact ctcacgccat ggcgtaccgg cagatcctgg cgatttcctt ctcgcggccc       720
     gggaccgctt tcgacattgt tcgctaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page