(data stored in ACNUC7421 zone)

EMBL: CP000094.PE30

CP000094.PE30        Location/Qualifiers
FT   CDS_pept        complement(32173..32574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71774"
FT                   /db_xref="GOA:Q3KKD2"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKD2"
FT                   /protein_id="ABA71774.1"
FT                   /translation="MTELHGGGCHCGHIRYQFSGPLHDIAHCHCSICRKVSGGIVTTWI
FT                   TLPAANFQWLTGKPSRYDSSTSCARFFCPNCGAHLALVTLLSPESIDLTIATLDHPEQA
FT                   AAERHIWTDSQLPWLHLDEHLPGEPEETI"
     atgactgagt tgcacggcgg tggctgtcac tgcggacata tccgctatca gttcagcgga        60
     ccgttgcacg acatcgccca ctgtcattgt tcgatctgtc gaaaggtcag cggcggcatc       120
     gtcaccacct ggatcacgct gccggcggcg aacttccagt ggctgacagg gaaaccttcg       180
     cgctatgact cgtcgaccag ttgcgcacgg tttttctgtc cgaactgcgg cgcacacctt       240
     gcgctggtga cgctgctcag ccccgagagc atcgatctga cgattgccac actggatcat       300
     ccagagcagg ccgccgccga gcggcatatc tggaccgaca gccagttacc gtggctgcat       360
     ctggacgagc atttgccggg cgaacccgaa gaaaccatct ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page