(data stored in ACNUC7421 zone)

EMBL: CP000094.PE301

CP000094.PE301       Location/Qualifiers
FT   CDS_pept        complement(351203..351469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72047"
FT                   /db_xref="InterPro:IPR021427"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJK9"
FT                   /protein_id="ABA72047.1"
FT                   /translation="MTNPHDLKTLGLTHFSFQSNHALFRTTPGVPVATALSHASHLLHI
FT                   SKLLTSDTSAANDPELHACASQYLQELSKALVDDAVKVLSSDP"
     atgaccaatc cccacgatct gaaaaccctc ggcctcaccc atttttcctt tcagtccaac        60
     cacgcactct ttcgcaccac ccccggcgtc ccggtcgcca ccgccctctc ccacgcatcc       120
     catctgctgc acatttccaa actgctcacc tcagatacct ctgccgccaa cgatccagaa       180
     ctccacgcct gcgcctcgca atatttgcag gagttgagca aggcgctggt cgatgatgcg       240
     gtcaaagtgc tgagctccga tccgtaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page