(data stored in ACNUC7421 zone)

EMBL: CP000094.PE303

CP000094.PE303       Location/Qualifiers
FT   CDS_pept        352128..352568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0305"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72049"
FT                   /db_xref="GOA:Q3KJK7"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJK7"
FT                   /protein_id="ABA72049.1"
FT                   /translation="MRGSVMFEYALEVHEEPGSVWLSCAEIPEMHAAGDTLEEALDGAI
FT                   DAMETALSIYVDDRRLIPTGDAGEQESDAVLRLPALTAAKVGLWNTLLESGVSKAELAR
FT                   RLGVQRPQVDRLVDFLHHSKIENVERALQQLGRRILLSVEAA"
     atgagaggaa gcgtgatgtt cgaatatgcg ttggaagtcc acgaagagcc gggcagtgtc        60
     tggttgtcct gcgcagaaat tccagagatg cacgccgctg gcgacaccct cgaggaagca       120
     ctcgacggcg ctatagatgc gatggaaacg gcattgtcga tttacgtcga tgatcgccgg       180
     ttgattccga caggtgatgc gggagagcag gaaagtgacg cggtattgcg tctgcctgca       240
     ctgactgccg caaaggtcgg gttgtggaat acgcttctgg agtctggggt gagcaaggct       300
     gagctggcac ggcgcttggg tgtgcaacga ccccaggtag atcggttagt cgatttcctg       360
     catcactcca agattgagaa tgttgagcgt gcgttgcagc agcttggacg ccggattttg       420
     ctttcggttg aggctgctta g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page