(data stored in ACNUC7421 zone)

EMBL: CP000094.PE304

CP000094.PE304       Location/Qualifiers
FT   CDS_pept        352739..352900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0306"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72050"
FT                   /db_xref="GOA:Q3KJK6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJK6"
FT                   /protein_id="ABA72050.1"
FT                   /translation="MGVSQSAFAKLIGVSLRTLQDWELGRRHPTGAAQTLLRVASQHPE
FT                   ALRDLQPA"
     gtgggcgttt cgcagagtgc gttcgccaag ttgatcggtg tgagtctgcg gacgttgcag        60
     gattgggaac tgggtcgcag gcacccgaca ggtgcggcac agacattgtt acgtgttgct       120
     agccagcatc cggaagcatt gcgggatttg cagccagcct ga                          162
//

If you have problems or comments...

PBIL Back to PBIL home page