(data stored in ACNUC7421 zone)

EMBL: CP000094.PE306

CP000094.PE306       Location/Qualifiers
FT   CDS_pept        complement(354343..355548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72052"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJK4"
FT                   /protein_id="ABA72052.1"
FT                   /translation="MLTGEALLARFTALDTFLTAHQALWKPRPFTHLHLPWEASYPELA
FT                   SWLRGRSLEDAENAHNQPAELLNAPEPFGSLAALSLELSAVGELPTHSLEAAGHRLNVD
FT                   VPGRKWQQIEAFASRLSFAAQPRHWLDWCSGKGHLGRRLLGADQQLTCLEYDPALVSSG
FT                   QALSQRHHLHALHVEQDVLAADTALLLNTEHTPVALHACGDLHVRLMQLASAAGCRQLA
FT                   IAPCCYNRISRTEYQALSSAGSRSVLQLSLEDLSLPMSETVTAGARVRRQRDTSMARRL
FT                   AFDLLQRQVRGVDEYLPVPSLPSVWLDKPFADYCHDLAALKELSTVGAPDWVALEAAGW
FT                   QRLAEVRNLELLRGLFRRPLELWLNLDRALFLTEQGYIVRLGTFCEAPLTPRNFLLLAE
FT                   RA"
     gtgctaacgg gcgaggccct actcgcccgt ttcacggcac tggatacatt tctcacagcg        60
     catcaggcgc tgtggaaacc ccgcccgttc actcatctgc acctgccctg ggaagcgtct       120
     tacccggaac tggcctcgtg gctacgcggg cggtcgctgg aagatgcaga aaacgcccac       180
     aaccaacccg ccgaactctt gaatgcgccg gagccgtttg gttcgttggc ggcgttgtcg       240
     cttgaactga gtgcggtggg tgaactgcct acacattcgc tggaagccgc cgggcatcgt       300
     ctgaatgtcg atgtgcccgg gcgcaaatgg cagcagatcg aagccttcgc cagccgcttg       360
     tcgtttgccg cgcaaccgag acactggctg gattggtgtt cgggcaaagg tcatttgggt       420
     cggcgtctgc tcggtgccga tcagcaactc acctgtctgg aatacgaccc ggcgctggtt       480
     tccagcggtc aggcactgag tcagcgtcat cacttgcatg cgctgcatgt cgagcaggat       540
     gtgctcgcag cggacacggc tttattgctg aacaccgaac acacccctgt cgccctgcac       600
     gcttgcggtg atttgcatgt gcggctgatg caactggcct ccgccgctgg ctgccgacaa       660
     ctggcaattg caccgtgctg ttacaaccgg atcagtcgca ccgaatatca ggcgttgtcc       720
     tccgcaggtt cacgctccgt cctacagctc tcgctggaag atctgtccct gccgatgagc       780
     gaaacggtca ccgccggtgc ccgcgtccga cgtcagcgtg acacctccat ggcccgccga       840
     ctggctttcg atctgttgca acggcaagtg cgtggcgtcg acgaatactt gccggtaccg       900
     tccctgccga gcgtctggct ggacaaaccg ttcgccgatt actgccacga tctggcagcg       960
     ttgaaagagt tatccacagt tggcgcgcca gattgggtag cactggaagc cgccggttgg      1020
     cagcgattgg ccgaagttcg caacctggaa ttgctgcgcg gactgttccg acggccgctg      1080
     gagctttggc tgaatcttga ccgagctctt ttcctcaccg aacagggata catcgtacgt      1140
     ctaggcacct tctgcgaggc accgctcaca ccgcgcaatt tcctgctgct ggccgaacgc      1200
     gcttaa                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page