(data stored in ACNUC7421 zone)

EMBL: CP000094.PE309

CP000094.PE309       Location/Qualifiers
FT   CDS_pept        complement(357019..357765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0311"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72055"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJK1"
FT                   /protein_id="ABA72055.1"
FT                   /translation="MQNYKKVFLAAAVTLAFSAGAMAETLKMGIEAAYPPFNNKDASGN
FT                   VVGFDKDIGDALCAKMKVECSVVTSDWDGIIPALNAKKFDFLISSMSITDERKGAVDFT
FT                   DPYYSNKLQFIAPKDKEFKTDKDSLKGKVIGAQRATLAGTFMEDNMPGVEVKLYDTQEN
FT                   AYLDLISGRLDGILADKYVNYEWLKSDAGKAYEFKGDPVEESDKIGIAVRKGDPIREKL
FT                   NAALKEIVADGTYKKINDKYFPFSIY"
     atgcagaact acaaaaaggt cttcctggcc gccgccgtca ccctcgcgtt cagcgccggt        60
     gccatggccg agaccctgaa gatgggcatc gaagcggctt acccgccgtt caacaataaa       120
     gacgccagcg gcaacgtcgt cggcttcgac aaagacatcg gcgacgccct gtgcgccaag       180
     atgaaagttg aatgctccgt ggtcacctcc gactgggacg gcatcatccc ggccctgaac       240
     gccaagaagt tcgactttct gatctcctcg atgtcgatca ccgacgagcg caagggcgcg       300
     gtggacttca ccgacccgta ctactccaac aaactgcaat tcatcgcgcc gaaggataaa       360
     gagttcaaga ccgacaagga ctccctcaaa ggcaaagtga tcggcgccca gcgcgcgacc       420
     ctcgccggta ccttcatgga agacaacatg ccgggcgtcg aagtaaaact ctacgacacc       480
     caggaaaacg cctacctcga cctgatctcc ggtcgcctgg acggcatcct cgccgacaaa       540
     tacgtcaact acgagtggct gaaaagcgac gccggcaaag cctatgaatt caagggcgat       600
     ccggtggaag aaagcgacaa gatcggtatc gctgtacgca aaggcgaccc gatccgcgag       660
     aagctgaatg ctgcgctgaa ggaaatcgtt gccgacggca cctacaagaa gatcaacgac       720
     aagtacttcc cgttcagcat ctactga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page