(data stored in ACNUC7421 zone)

EMBL: CP000094.PE312

CP000094.PE312       Location/Qualifiers
FT   CDS_pept        complement(360567..361019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJJ8"
FT                   /protein_id="ABA72058.1"
FT                   /translation="MASLNKQQKRAKRAKAKAKQIRMVGRKPLAQDDDLGHLAEPIPEY
FT                   TLAMFSKMRDAEAVSRNEMLLTLLRELAFIIVDHPDLLDMENAENEGMAATHLAADMLI
FT                   DYRMWADGMDRETAQAWLSEPEFISDFGIALDTYGQSVEAQEEKSE"
     atggcatccc tgaacaagca acagaaacgc gccaaacgcg ccaaggccaa agccaagcag        60
     atccgcatgg tcggtcgcaa acccctggcg caggacgatg accttggcca tctggccgag       120
     ccgatcccgg aatacacctt ggcgatgttc agcaagatgc gcgacgccga agccgtcagc       180
     cgcaatgaaa tgctgctgac gctgctgcgt gagctggcgt ttataatcgt cgatcatcct       240
     gatctgctgg acatggaaaa cgccgagaac gaaggcatgg ccgccactca cctggccgcc       300
     gacatgttga tcgactaccg catgtgggcc gacggcatgg atcgcgagac cgcccaggcg       360
     tggctgagcg aaccggagtt catcagcgat ttcgggattg cgctggacac ttacggtcag       420
     tcggtggaag cgcaggaaga gaagagcgaa taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page