(data stored in ACNUC7421 zone)

EMBL: CP000094.PE313

CP000094.PE313       Location/Qualifiers
FT   CDS_pept        complement(361026..361439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0315"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72059"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJJ7"
FT                   /protein_id="ABA72059.1"
FT                   /translation="MASANKQQKRAARAKTKAKQNRTKRAEAPVELDPNDDRIDFESVD
FT                   LTELFKKMIDAEKISQQALCTAFLEDPLLELVYEQEGEEGAMDFILAALIEYRQWSTET
FT                   DEAGALAWIESPDFQKDYVAASDAIAAQTQQKN"
     atggcttccg ccaacaagca gcaaaaacgc gccgcccggg ccaagaccaa ggccaagcag        60
     aaccgcacca aacgtgcgga agcgccggtc gagctggacc cgaacgacga ccgcatcgat       120
     ttcgaatcag tggacctcac cgaactgttc aagaaaatga tcgacgccga gaagatcagc       180
     cagcaggccc tgtgcaccgc gttcctcgaa gacccgttgc tggagctggt gtacgagcag       240
     gaaggcgaag aaggcgcaat ggacttcatc ctcgccgcgc tgatcgagta ccgccagtgg       300
     tccaccgaga ctgacgaggc tggcgctctg gcgtggatcg aatcgccgga tttccaaaaa       360
     gactatgtgg ccgcgtccga cgcaatcgcc gcacaaaccc aacagaaaaa ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page