(data stored in ACNUC7421 zone)

EMBL: CP000094.PE317

CP000094.PE317       Location/Qualifiers
FT   CDS_pept        complement(363779..364051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72063"
FT                   /db_xref="GOA:Q3KJJ3"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJJ3"
FT                   /protein_id="ABA72063.1"
FT                   /translation="MTRTVMCRKYKEQLEGLERPPYPGAKGQDIFEHVSAKAWADWQKH
FT                   QTLLINEKRLNMMNAEDRKFLQGEMDKYFSGEEYAQAEGYVPPAE"
     atgacccgca ccgtaatgtg ccgcaagtac aaagaacaac tcgaaggtct ggagcgccca        60
     ccgtacccgg gtgccaaggg ccaggatatt ttcgaacacg tctcggccaa ggcctgggcg       120
     gactggcaga aacaccagac cctgctgatc aacgaaaaac gcctgaacat gatgaacgcc       180
     gaagaccgca aatttcttca gggcgaaatg gacaagtact tctccggcga ggaatacgct       240
     caggccgaag gctacgttcc gcctgcagag taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page