(data stored in ACNUC7421 zone)

EMBL: CP000094.PE325

CP000094.PE325       Location/Qualifiers
FT   CDS_pept        371844..372614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0327"
FT                   /product="imidazole glycerol phosphate synthase subunit"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72071"
FT                   /db_xref="GOA:Q3KJI5"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJI5"
FT                   /protein_id="ABA72071.1"
FT                   /translation="MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGA
FT                   DEITFLDITASVDGRDTTLHTVERMASQVFIPLTVGGGVRTVQDIRNLLNAGADKVSIN
FT                   TAAVFNPEFVGEAAQHFGSQCIVVAIDAKKVSGPGETPRWEIFTHGGRKPTGLDAVEWA
FT                   KKMEGLGAGEILLTSMDQDGMKNGFDLGVTRAISDALGIPVIASGGVGNLQHLADGILE
FT                   GHASAVLAASIFHFGEYTVQEAKAYMSKRGIVMR"
     atggcgctgg ccaaacgcat catcccttgc ctggacgtgg acaacggccg ggtcgtcaaa        60
     ggtgtgaagt tcgagaacat ccgtgacgcc ggcgatccgg tggaaatcgc ccgtcgctac       120
     gacgagcagg gtgccgacga gattactttt ctcgacatca ccgccagcgt cgatggccgt       180
     gacaccacgc tgcacaccgt cgagcgcatg gccagccagg tgttcatccc gctgaccgtc       240
     ggcggtggcg tgcggaccgt gcaggacatt cgcaacctgc tcaatgccgg tgcggacaag       300
     gtgtcgatca acaccgctgc cgtgttcaac ccggaattcg tcggcgaagc ggcgcagcat       360
     ttcggctcgc aatgcatcgt tgtcgccatc gacgcgaaga aggtctccgg cccgggcgaa       420
     accccgcgct gggagatctt tacccatggc ggccgcaagc cgaccggcct cgacgcggtc       480
     gagtgggcga agaaaatgga aggcctgggt gccggtgaaa tcctcctgac cagtatggat       540
     caggacggca tgaaaaacgg tttcgacctc ggcgtgaccc gcgccatcag cgatgcgctg       600
     ggtattccgg tgatcgcgtc cggcggcgtc ggcaacctgc agcatctggc tgacggcatt       660
     cttgaaggtc acgccagcgc ggtgctggcg gcgagtattt tccacttcgg cgaatacacg       720
     gttcaagaag ccaaggctta catgtctaaa cgcggcatcg taatgcgtta a                771
//

If you have problems or comments...

PBIL Back to PBIL home page