(data stored in ACNUC7421 zone)

EMBL: CP000094.PE326

CP000094.PE326       Location/Qualifiers
FT   CDS_pept        372691..373446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0328"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72072"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJI4"
FT                   /protein_id="ABA72072.1"
FT                   /translation="MIKRLLLALASASVLLINTGHAEESPDTDLVLLTENFPPYNMAKN
FT                   GKNFAQDENINGIATDIVREMFKRAGITYSLTLRFPWERVYKLALENPGYGAFVMARLP
FT                   DREKLFKWVGPIGPDDWVMLAKADSKITLETLNDARKYKIGAYKGDAIAETLTKQGLKP
FT                   VVVLRDQDNARKLVSGQIDLWATGDPAGRYLARQDGVTGLKTVLRFNSAELYLALNKDV
FT                   PDATVARLQAELDQMRKDGVVDEIMGRYL"
     atgatcaaac gcctgcttct cgccctcgcc agtgcctccg tgttgttgat caacaccggc        60
     cacgccgagg aaagtcccga caccgatctg gtgctcctca ccgaaaactt cccgccgtac       120
     aacatggcga agaacggcaa gaatttcgcc caggatgaaa acatcaacgg catcgccacg       180
     gacatcgtgc gcgagatgtt caagcgtgcc ggcatcactt acagcctgac cctgcgcttc       240
     ccctgggagc gggtctacaa gctggcgctg gaaaatcccg gttacggtgc gttcgtcatg       300
     gcgcggctgc cggatcgcga aaagctcttc aaatgggtcg gcccgatcgg cccggacgac       360
     tgggtcatgt tggccaaggc cgacagcaag atcaccctcg aaaccctcaa tgatgcgcgc       420
     aagtacaaga tcggcgccta caagggtgat gcgattgccg agactttgac caaacagggg       480
     ctgaagccgg tggtggtgct gcgtgatcag gacaacgcca ggaaactcgt cagcggtcag       540
     atcgatctgt gggccaccgg cgatcctgcc ggccgttatc tggcacggca ggatggcgtg       600
     accgggttga aaaccgtact gcgcttcaac agtgccgaac tgtatctggc actgaacaaa       660
     gacgtgcccg atgcaacggt tgcccggttg caggccgagc tggatcagat gcgcaaggac       720
     ggtgtggtcg atgagatcat gggacggtat ttgtag                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page