(data stored in ACNUC7421 zone)

EMBL: CP000094.PE339

CP000094.PE339       Location/Qualifiers
FT   CDS_pept        complement(385516..386139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72085"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJH1"
FT                   /protein_id="ABA72085.1"
FT                   /translation="MRRGLIALCLSLIAFGASAEVFTYIDAQGNRVYTDQPRGNAKRVP
FT                   LATSNRMASNPTATAPVKPSMKSAEPPLFHYDMLRVLIPEPDATIRSSAGELIVSVTSE
FT                   PGLQKGHLYRLLLDGQAVGEPGLSPVFPLSNIDRGSHNLSVEILDAQGRTVEKTANQPF
FT                   HMQRISLAQKRQVKPCVSADYGVRPECPLKDKPAEPKNPFLRFF"
     atgaggcgag gattgattgc cttgtgcctg tcgctgatcg cgtttggcgc atcggccgag        60
     gtgttcactt acatcgatgc acagggcaat cgcgtctaca ccgatcaacc gcgcggcaac       120
     gccaagcgtg tgccgctggc caccagcaat cgcatggcct cgaatccaac cgccactgca       180
     ccggtcaagc cgtcgatgaa atcagcagag ccgccgctgt tccactacga catgctgcgg       240
     gtgctgatcc ccgagccgga cgcgaccatt cgcagcagcg ccggagagct gatcgtcagc       300
     gtcaccagcg agccgggcct gcaaaaaggt catttgtatc gcctgctgct ggatggccag       360
     gccgtcggcg aacccggcct gagcccggtg ttcccgctga gcaacatcga tcgtggcagc       420
     cacaacctgt cggtggaaat cctcgacgcc caaggccgga ccgtggagaa aaccgccaac       480
     cagccgttcc acatgcagcg catttccctg gcacagaagc gtcaggtcaa accgtgtgtc       540
     agcgccgact acggcgttcg cccggaatgc ccgctgaaag acaaacccgc cgaaccgaaa       600
     aatcctttcc tgcgtttctt ctga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page