(data stored in ACNUC7421 zone)

EMBL: CP000094.PE343

CP000094.PE343       Location/Qualifiers
FT   CDS_pept        389599..389853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72089"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJG7"
FT                   /protein_id="ABA72089.1"
FT                   /translation="MDALNSGDAGANTLPRQPASQGSKLHASAPAWVFCPKFTLLKVES
FT                   ALKAKISPFNVALKSKNDPFWCVQNLLHINWLNLEQFPL"
     gtggatgccc ttaatagtgg tgatgccggc gcgaatactc tgccaaggca acctgcctca        60
     caagggagca aattgcatgc cagtgcccca gcatgggttt tttgccccaa attcacgctt       120
     ctgaaggtcg aaagcgcctt aaaggcgaaa atctcgccct ttaatgtagc gctcaaatcg       180
     aaaaatgacc cgttttggtg cgtgcaaaac cttctgcaca ttaactggtt aaaccttgag       240
     caatttccgc tataa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page