(data stored in ACNUC7421 zone)

EMBL: CP000094.PE348

CP000094.PE348       Location/Qualifiers
FT   CDS_pept        396859..400455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0350"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72094"
FT                   /db_xref="GOA:Q3KJG2"
FT                   /db_xref="InterPro:IPR019286"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJG2"
FT                   /protein_id="ABA72094.1"
FT                   /translation="MQWMFMLIGLLLGWLLDESFSDALLGALLGLAIGQAMLIARLGSQ
FT                   AAEQQRQLDHAKIALQGVEQRLFLLEGAPAHSPASPSVAPVSETIVEPVTVFEQPAAAE
FT                   PELVWELPPELEPVAVAASASSQPLPVDVWRLDAVTPEPEPRQPAEPRGPNLIERGISA
FT                   ARNWLFGGNTVLRVGVVLLFFGLAFLLRYATEGMVVPIELRYAGVAAAALGLLALGWWL
FT                   RHRNNSYALMLQGTGIAVLYLTVFAAMRLHPLLDPSAALGLLVAVTVFSAILAITQDSL
FT                   ALACVAALGGFAAPILTSTGAGNHVALFSYFALLNAGILAIAWFKAWRLLNLIGFVGTF
FT                   GIGFAWGLRSYTPELLWSTEPFLILFFLMYLAIGLLFARRKLLDMPDAPADDDREALLH
FT                   WSARKGDYVDGTMLFGPPLVGFGLQFALVQHLEFAAAFSALALGMIYMALAKVLMGGRA
FT                   LLLGETCLALGVIFASLAIPLGLDARWTSAAWAVEGAGIFWLGLRQQRPLARAFALLLQ
FT                   LGSALAFLSQLRVGESSLLDGAPLGALMLGAALLFSFYQLRKASPEQTSPWERQGLPVL
FT                   ACLGLTFLYLLASLFFFIQGTAISWALAGLATLFVGLRLQSRTFLFTAFAVQLLGGALF
FT                   LLRLQGAGEDSAAVFSAGWSGLLSASLIGLALIAGMLLAARDEMVRSDVRLLRGLSVVL
FT                   LAGLVLINLAVLFVLPWQTASAVWAASGLLIIWLSLYLKQRVSFVFGLLLQLIGGAAFL
FT                   LAGPELLGLLSSEGLRPLAHGGFWTPLVLGLAAMIGAWRLQLGNHASAFDVLSLQRLSE
FT                   VLLVWGAGWWALAWVSEVLRFAPQNLQATLLLLVAALSVALWTLLALRLKWPSLGLLCT
FT                   VLIPAAGLVLLGAWHSRYHPAADFGWLVWAAVFVVHFISLRRLAPMLPARALSTAHVLG
FT                   CWLLIGVLALELRYGLLLLSEQYNAWRWLGWAILPSLYLLLMAAPRQWPWPVAAFPREY
FT                   RLYAAAPLAVLMLVWFWLANGVSDGNAEPLPYVPLLNPLELGLLFALFGVYVWSRSAVA
FT                   ELSIRQDYAAYATQLIAGVSLFAFCTALVTRAAHHWAGIPFELDLLLESMLVQAGLSIV
FT                   WTLMALGLMIGGHLRHRREVWLIGAALIALVVAKLIFVELSNRGGLARIVSFIGVGVLL
FT                   LVVGYFAPLPPKRVDAAPAADKPAPETEGVSS"
     atgcaatgga tgttcatgtt gatcgggctg ctgctcggct ggctgctcga cgagtcgttc        60
     agcgatgcgc tgttgggcgc cttgctcggg ctcgccattg gccaggcgat gcttatcgcg       120
     cggctcggtt cacaggctgc cgagcaacag cgtcagctgg atcacgcgaa gattgcgttg       180
     cagggcgtcg aacagcgtct gtttctgctg gaaggcgctc cggcgcattc gccagcgtcg       240
     ccgagcgtcg cgccggtcag cgaaacgatc gttgaacccg tcacggtatt tgaacaaccc       300
     gctgccgcag aacccgagct ggtctgggaa ctgcctcccg agctcgaacc tgttgctgtc       360
     gccgccagcg catccagcca gccgctgccg gtcgatgtct ggcgtctgga cgccgttacg       420
     cccgagcctg aaccccgaca acccgccgaa ccccgtggcc cgaacctcat cgagcgcggc       480
     atcagcgctg cgcgcaactg gctgttcggt ggcaacaccg tgctgcgggt cggcgtggtg       540
     ttgttgtttt tcggtctggc gttcctgctg cgctacgcca ccgaaggcat ggtggtgccg       600
     atcgaattgc gttacgccgg agttgcggcg gcagcactgg gcttgctggc gctgggctgg       660
     tggttgcgcc atcgcaacaa cagctacgcc ttgatgctgc aaggcaccgg gatcgcagtg       720
     ctgtacctga cggtgtttgc ggcgatgcgt ctgcatccgc tgctcgatcc gtctgccgcg       780
     ctgggattgc tggtggcagt gacggtgttt tcggccattc tggccatcac ccaggattcc       840
     ctcgctctag cctgcgtcgc cgcactgggc ggtttcgccg cgccgattct gacctccacc       900
     ggcgccggca accacgtcgc gctattcagt tatttcgcgc tgctcaacgc cggcattctg       960
     gccatcgcct ggttcaaggc ctggcgcctg ctcaacctga tcggcttcgt tgggaccttc      1020
     ggcatcggtt tcgcctgggg cctgcgttcg tacacgccgg aactgctgtg gagcaccgaa      1080
     ccgttcctga ttctgttctt cctgatgtac ctggccatcg gcctgctgtt cgcccgacgc      1140
     aagttgctgg acatgccgga cgccccggcg gacgacgatc gcgaggcgct gctgcactgg      1200
     tcggcgcgca agggcgatta cgtcgacggg acgatgctgt tcggcccgcc gctggtgggt      1260
     ttcggcctgc aattcgcgct ggtgcagcat ctggaattcg ctgccgcgtt cagtgcgctg      1320
     gcgctgggca tgatctacat ggccctggcc aaagtgctga tgggcggccg ggcgttgttg      1380
     ctgggtgaga cttgcctggc gcttggggtg attttcgcca gcctggcgat tccgctgggg      1440
     ctggatgcac gctggacatc tgccgcgtgg gcggtggagg gtgcggggat tttctggctg      1500
     ggcttgcgcc agcaacggcc gttggcccgg gctttcgcat tgctgttgca actgggttcg      1560
     gcgctggcgt ttctcagcca gttgcgcgtc ggcgaaagca gcctgctcga cggagcgcct      1620
     ctgggcgcat tgatgctcgg cgcggcgttg ctgttcagct tctatcaatt gcgcaaggcg      1680
     tcgccggagc aaacttcacc ttgggagcgt cagggtttgc cggtgctggc gtgcctgggg      1740
     ctgaccttcc tgtatctgct ggcgtcgctg ttcttcttca ttcagggcac ggcgatcagt      1800
     tgggcattgg ccgggctggc gaccttgttc gtcggcttgc gcctgcaatc gcgcacgttc      1860
     ctgttcaccg cgtttgccgt gcagttgctt ggcggggcgt tattcctgtt gcgcctgcaa      1920
     ggggcgggcg aggattcggc ggccgtgttc agcgccggct ggagcggtct gctcagcgcc      1980
     tcgctgatcg gtctggcgct gatcgccggc atgctgctgg cggcgcgtga cgagatggtg      2040
     cgcagcgatg tgcggctgct gcgcggtttg tcggtggtgc tgctggcggg gctggtactg      2100
     atcaatctgg cggtgttgtt cgtgctgccg tggcaaaccg cgagtgccgt ttgggcggcc      2160
     agtggcttgc tgatcatctg gctcagtctg tacctcaagc agcgcgtgag ttttgtgttc      2220
     ggtctgctgt tgcaactgat cggcggcgcg gcgtttctgc tcgccggtcc cgagctgctc      2280
     gggctgctgt ccagcgaggg gctgcgaccg ctggcccatg gcggattctg gacgccactg      2340
     gtgctgggcc tggcggcgat gatcggagcg tggcgcctgc aacttggcaa tcatgcctcg      2400
     gcgttcgatg tgctgagtct gcagcgactt tcggaagtgt tgctggtgtg gggcgccggt      2460
     tggtgggcgc tggcgtgggt cagcgaagtg ctgcggtttg cgccgcagaa tctccaggcg      2520
     acgctgttgc tgctggtggc cgcgctgagc gtcgcgttgt ggacgttgtt ggccttgcgt      2580
     ctgaaatggc cttcgctcgg gttgctctgc accgtgctga ttccggcggc cggacttgtg      2640
     ttgctcggcg cgtggcactc gcgttatcac ccggcggcgg atttcggctg gctggtgtgg      2700
     gcggcggtgt tcgttgtgca tttcatcagc ctgcgacgtc tggcaccgat gctgccggcg      2760
     cgggccttga gcacggcgca tgtgctcggt tgctggctgc tgatcggcgt gctggcgctg      2820
     gaattgcgct acggcctgct gctgttgtcc gagcaataca acgcctggcg ctggctgggc      2880
     tgggcgattc tgccgagttt gtatctgttg ctgatggccg caccgcgtca gtggccatgg      2940
     ccggtggcag cgttccctcg tgaatatcgc ctgtacgcgg cggcgccgct ggcggtgttg      3000
     atgctggtct ggttctggct ggccaatggc gtcagcgatg gcaatgccga accgttgcct      3060
     tatgtgccgc tgctcaaccc gctggagttg ggtctgctgt ttgcgctgtt cggtgtttac      3120
     gtctggtcgc gcagcgccgt agccgagctg tcgatccgcc aggattacgc ggcatacgct      3180
     acgcaactga ttgccggcgt ttcgctgttc gcgttctgca ctgcgctggt gacccgcgcc      3240
     gcgcaccatt gggcggggat tccgttcgaa ctcgatctgc tgctcgaatc gatgctggtg      3300
     caggccggtc tgtccatcgt ctggacgctg atggcgctgg gtctgatgat cggcgggcac      3360
     ctgcgtcatc gccgcgaagt gtggctgatc ggcgcggcgc tgattgcgct ggtggtggcc      3420
     aaactgattt ttgtcgaatt gagcaaccgt ggcggactgg cccggatcgt ctcgttcatc      3480
     ggcgtcggcg ttttgttgct ggtggtgggc tactttgcgc cgctgccgcc caaacgcgtt      3540
     gacgctgcac cggcggcgga caaaccggcc ccggaaaccg aaggagtgtc gtcttga         3597
//

If you have problems or comments...

PBIL Back to PBIL home page