(data stored in ACNUC7421 zone)

EMBL: CP000094.PE36

CP000094.PE36        Location/Qualifiers
FT   CDS_pept        40070..41098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0036"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71780"
FT                   /db_xref="GOA:Q3KKC6"
FT                   /db_xref="InterPro:IPR016937"
FT                   /db_xref="InterPro:IPR022606"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKC6"
FT                   /protein_id="ABA71780.1"
FT                   /translation="MSKLTLLIQRILELMKRYPGVIALGGFISGVGSFILVDRQQGLAS
FT                   WITTIMLLSWIWLMLENSLTRLFTRIFKREIPQPLLRYATQMIHQESLFFVLPFFFITT
FT                   TWNSGQLFFTGLLCIAALISIVDPLYYKWLAPRRWAFLALHTLTLFAALLTALPVIMHL
FT                   TTSQSFKWALGIAVLLSFPSLASIFPIRTVRNALAILCITVGIGGVGWVLRSWVPPATL
FT                   WMTDVAISTQVQDRVPGASLKEVSAEQIRGGGLYAYTAINAPRGLDERIYHVWQFNGKE
FT                   VDRIALDIHGGRKEGYRAWTHKQNFPGNPAGKWQVRVLTEDGQVIGVLRFEVTDSTPTK
FT                   EK"
     atgtctaaat tgaccctcct gatccagcgc attctcgaac tgatgaagcg ctaccccggg        60
     gtcattgcgc tcggtggttt catctccggg gtcggcagct tcattctggt cgatcggcaa       120
     cagggcctgg cgagctggat caccacgatc atgctgctga gctggatctg gctgatgctg       180
     gaaaacagcc tgaccaggct gttcacaagg atcttcaaac gggaaatccc ccagccgctg       240
     ctgcgttacg cgacgcagat gatccaccag gaaagcctgt ttttcgtcct gccgttcttc       300
     ttcatcacca ccacctggaa cagcggccag ctgtttttca ccgggctgtt gtgcatcgcg       360
     gcgctgatct cgatcgtcga cccgctctac tacaagtggc tggcgccacg gcgctgggcg       420
     ttcctcgcgc tgcataccct gaccctgttc gccgccctgc tcacggcgct gccggtgatc       480
     atgcacctga ccacctcgca gagcttcaaa tgggcactgg ggattgcggt gctgctgtcg       540
     ttcccgagcc tggcgtcgat cttcccgatc cgcaccgtac gcaatgcctt ggcgatcctg       600
     tgtatcacgg tcggcatcgg tggcgtgggc tgggtcctgc gttcgtgggt gccgccggcg       660
     acgctatgga tgaccgacgt ggcgatcagc actcaggtgc aggaccgggt tccgggcgcc       720
     agcctcaagg aagtcagcgc cgagcagatc cgtggtggcg ggctctacgc ctacaccgcg       780
     atcaacgcgc cgcgcgggct cgacgagcgg atttatcacg tctggcagtt caacggcaaa       840
     gaggtcgacc gcatcgccct cgacattcac ggcgggcgca aggaaggcta ccgggcctgg       900
     acccacaagc agaacttccc cggcaacccg gcgggcaagt ggcaggtgcg ggtgttgacc       960
     gaggacggac aggtgatcgg cgtgctgcgc ttcgaggtca cggacagcac accgaccaaa      1020
     gaaaagtaa                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page