(data stored in ACNUC7421 zone)

EMBL: CP000094.PE367

CP000094.PE367       Location/Qualifiers
FT   CDS_pept        421913..422929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0369"
FT                   /product="putative glycine betaine/L-proline-binding
FT                   protein ABC transporter component"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72113"
FT                   /db_xref="GOA:Q3KJE3"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJE3"
FT                   /protein_id="ABA72113.1"
FT                   /translation="MFRPRCKKTPIRTIIRCRTRRSLMKKLFTRCALILTGSALLSAGA
FT                   MASDDASCKTVRMGVVNWTDVIATSGMADVLLNGLGYESKQTSAVQQIIFAGIRDKRLD
FT                   IFLGYWKPAMDKNIAPFLAANQVKVMDKPSLADAQATLAVPDYVAAAGLKTFGDIAKFK
FT                   DQLGGKIYGIEPGSGANTTIKTMIETNHFGLKDFKIIESGEAGMLAAVQRAVNRKEFVV
FT                   FVGWTPHPMNINMKITYLTGSEDVYGPNEGAATVSTVTAPDYAERCPNVHRLLENLTFT
FT                   AAQESQLMVPIMERKTPQEVAKTWLREHPEDLQRWLAGVSSFDGKDGVATVQASLKN"
     atgtttcgac cacggtgcaa gaagacaccg atccgaacaa taatccgctg ccgcacgaga        60
     cgatccctca tgaaaaaact gttcactcgt tgtgcgttaa tcctcaccgg cagtgcgctg       120
     ctcagcgccg gcgccatggc ctccgacgat gcctcctgca aaaccgtgcg catgggcgtg       180
     gtcaactgga ccgacgtgat cgccaccagc ggcatggccg acgtgctgct caacggcctc       240
     ggctacgaaa gcaagcagac cagcgccgtg cagcaaatca tcttcgccgg catccgcgac       300
     aagcgcctcg atatcttcct cggctactgg aaaccggcga tggacaagaa catcgcgccg       360
     ttcctcgccg ccaatcaggt caaggtcatg gacaagccca gcctggccga cgcccaggcg       420
     accctggcgg ttccggacta tgtggcggcg gcagggctga agacctttgg cgacatcgcg       480
     aaattcaagg atcagctagg tggcaaaatc tacggcatcg agcccggcag cggcgccaac       540
     accacgatca agacgatgat cgaaaccaac catttcggcc tgaaggattt caagatcatc       600
     gaatccggtg aggccggcat gctcgccgcc gtgcagcgag cggtgaaccg caaggaattc       660
     gtggtgttcg tcggctggac cccgcacccg atgaacatca acatgaaaat cacctacctg       720
     accggcagcg aagacgtcta cggcccgaac gaaggcgccg ccaccgtgtc caccgtcacc       780
     gcgccggact acgccgagcg ctgcccgaac gtccatcgtc tgctggaaaa cctgaccttc       840
     accgccgccc aggaaagcca gttgatggtg ccgatcatgg agcgcaagac accacaggaa       900
     gtggcgaaaa cctggctgcg cgagcatccc gaagacctgc aacgctggct ggcgggtgtc       960
     agcagtttcg atggcaagga cggcgtggcc acggttcagg ccagcctgaa aaactga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page