(data stored in ACNUC7421 zone)

EMBL: CP000094.PE373

CP000094.PE373       Location/Qualifiers
FT   CDS_pept        430418..431215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0375"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72119"
FT                   /db_xref="GOA:Q3KJD7"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJD7"
FT                   /protein_id="ABA72119.1"
FT                   /translation="MKKYLSMLLVGVTALVAVNAAQAGAIDDAVKRGSLKVGMDPTYMP
FT                   FEMTNKRGEIIGFEVDILKAMTKAMGVKLELVSTGYDGIIPALMTDKFDMIGSGMTLTQ
FT                   ERNLRLNFSEPFIVVGQTLLIRKELEGTIKSYKDLNTADYRITSKLGTTGEMVAKKLIS
FT                   KAKYHGYDNEQEAVLDVVNGKADAFIYDAPYNVVAVNKVGAGKLVFLDKPFTYEPLAFG
FT                   LKKGDYDSLNFINNFLHQIHEDGTYDRIHDKWFKSTEWLKDME"
     atgaagaagt atctgtcgat gctgctggtc ggcgtcacgg cactggttgc agtcaatgcg        60
     gcgcaggccg gcgcaatcga cgacgcggtc aagcgcggct cgttgaaagt cggtatggat       120
     ccgacctaca tgccgttcga aatgaccaac aagcgcggcg aaatcatcgg tttcgaagtc       180
     gacatcctca aagccatgac caaggccatg ggcgtcaagc tggagctggt ctccaccggt       240
     tacgacggga tcatcccggc gctgatgacc gacaagttcg acatgatcgg cagcggcatg       300
     accctgaccc aggaacgcaa cctgcgcctg aacttcagcg aaccgttcat cgtggtcggc       360
     cagaccctgc tgatccgcaa agagctggaa ggcaccatca agtcctataa agacctgaac       420
     accgccgact accgcatcac ctccaagctc ggcacgaccg gcgagatggt cgccaagaag       480
     ctgatctcca aggccaagta ccacggctac gacaacgagc aggaagccgt gctcgacgtg       540
     gtcaacggca aggctgacgc cttcatctac gacgcgccgt acaacgtcgt tgccgtgaac       600
     aaggtcggcg ccggcaaact ggtgttcctc gacaagccgt tcacctacga gccactggcc       660
     ttcggtctga agaagggtga ctacgacagc ctcaacttca tcaacaactt cctgcaccag       720
     atccacgaag acggcaccta cgatcgcatc catgacaagt ggttcaagag caccgagtgg       780
     ctcaaggaca tggaataa                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page