(data stored in ACNUC7421 zone)

EMBL: CP000094.PE377

CP000094.PE377       Location/Qualifiers
FT   CDS_pept        complement(435130..435837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0379"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72123"
FT                   /db_xref="GOA:Q3KJD3"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJD3"
FT                   /protein_id="ABA72123.1"
FT                   /translation="MNLLLLEEADFIAADRVVLRDRRLTHMQEVHRSEVGDSLRVGCIG
FT                   GLMGSAELLRLDAGEAELRVNLDQPPPAKLPLTLVLALPRPKMLRRVFQTVATMGVSKV
FT                   ILVNSYRVEKSFWQTPFLEPDAIREQLILGLEQARDTVLPEIIIEKRFKPFVEDRLPAI
FT                   TDGTLGLVGHPGNFPPCPRALNEPVTLAIGPEGGWIPYEIDLLAKAGLQPVQLGERILR
FT                   VETAVTALLARLF"
     atgaacctgc tgctgctcga agaggccgac ttcattgcgg ccgaccgcgt cgtgctgcgt        60
     gatcggcgcc tgacccacat gcaggaagtc caccgttcgg aagtcggcga cagcctgcgg       120
     gtcgggtgca ttggcgggct gatgggctcg gccgagcttt tgcgccttga cgcgggcgaa       180
     gccgagctgc gagtcaacct cgatcaaccg ccaccggcca aactgccgct gaccctggtg       240
     ctcgccctgc cccgcccgaa gatgctgcgc cgggtgttcc agaccgtggc gaccatgggc       300
     gtgtcgaagg tgattctggt caacagctac cgggtcgaga aaagcttctg gcagacgccg       360
     ttcctcgaac cggacgccat ccgcgaacaa ctgatcctcg gcctcgaaca ggctcgggat       420
     acggtgctgc cggagatcat catcgagaag cgcttcaagc cgttcgtcga agatcgcctg       480
     ccggccatca ccgacggcac cctcggtctg gtcggtcatc cgggcaactt cccgccctgc       540
     ccccgcgccc tgaacgaacc ggtgaccctg gccatcggcc ccgagggtgg ctggattccc       600
     tacgaaatcg atctgctggc caaggccggg ctgcaaccgg tgcaactggg cgagcgaatc       660
     ctgcgggtcg aaaccgccgt caccgcgctg ctcgcccggc tgttctga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page