(data stored in ACNUC7421 zone)

EMBL: CP000094.PE387

CP000094.PE387       Location/Qualifiers
FT   CDS_pept        442050..442472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0389"
FT                   /product="putative polyhydroxyalkanoate
FT                   biosynthesis-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72133"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJC3"
FT                   /protein_id="ABA72133.1"
FT                   /translation="MAKVILKKKIDASTSALSDVKSYARKIWLAGLGAYTKVGQEGSEY
FT                   FQELIKAGQTVEKKGKKAVTEKLEAANAEIDEAKSEVSSFKGRVEVQLDKVEKAFDTRV
FT                   ASALNRIGIPSKHDVEALSAKLDELTALLERVARKS"
     atggccaaag tcattttgaa gaaaaaaatc gacgcttcga cttccgctct gagcgacgtc        60
     aaatcctatg cccgcaagat ctggctggca ggcctggggg cctacaccaa ggtcggtcag       120
     gagggcagcg agtactttca ggagttgatc aaggctggtc aaactgttga aaagaaaggc       180
     aaaaaagccg tcaccgaaaa actcgaagca gccaacgccg agatcgatga agccaagagc       240
     gaagtcagct ctttcaaagg ccgggtcgaa gttcagctgg acaaggtcga gaaggccttc       300
     gacacacgtg tcgccagtgc cttgaatcgt atcggcattc cgtctaaaca tgacgttgag       360
     gcactctctg ctaagctcga tgagctgacg gcattgctcg aacgcgtcgc gcgtaaatct       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page