(data stored in ACNUC7421 zone)

EMBL: CP000094.PE396

CP000094.PE396       Location/Qualifiers
FT   CDS_pept        complement(451341..452057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72142"
FT                   /db_xref="GOA:Q3KJB4"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJB4"
FT                   /protein_id="ABA72142.1"
FT                   /translation="MAAKKKPAPKRGASRYQAPAKQPIPGWLWMAIGLTVGAFIVFLMK
FT                   LEPGKGSDTVKREKIEQQQQQKATKIAEANKTPPSPTQPVKPKYDFYTLLPESEVIVPP
FT                   DAVPEKTLPTPQVPAIPTTPVTPAEAAKIDTARAQAALAGITPPPAPPVTKAAPVTKFF
FT                   LQAGSFRKETDADKVRAQIILLGQAVAVESGTVKDETWYRVLVGPFSNREQLTTAQKQL
FT                   AGAGFSNLLLQQRQSR"
     ttggctgcca agaaaaaacc tgcacccaag cgtggcgcca gccgttacca agctccagcg        60
     aagcagccga ttccgggctg gctgtggatg gccatcggcc tgacggtcgg cgcgttcatc       120
     gtattcctga tgaaactgga gccgggcaag ggcagcgaca cggtcaagcg cgagaagatc       180
     gagcaacagc aacaacagaa agccaccaag atcgccgagg ccaacaagac cccgccgagc       240
     ccgacgcaac cggtgaagcc gaagtacgac ttctacacct tgctgccgga atcggaagtg       300
     atcgtgccgc cggacgcggt gcctgagaaa accctgccga cgccacaggt gccggcaatc       360
     ccgaccacgc cggtgacccc ggcggaagcg gcgaagatcg acaccgcacg ggcacaggct       420
     gcactggccg ggatcacccc gccgccagcg ccgccggtga ccaaggctgc accggtgacc       480
     aagttcttcc tccaggccgg ctcgttccgc aaagaaacgg atgccgacaa ggtgcgcgcg       540
     cagatcattc tgctcggtca ggcggtcgcg gttgaatccg ggacagtgaa ggatgaaacc       600
     tggtaccgcg tactggtcgg cccgttcagc aaccgcgaac agctgaccac cgcccagaaa       660
     caactggcgg gcgccggctt cagcaacctg ttgttacaac aacgccagag ccgctga          717
//

If you have problems or comments...

PBIL Back to PBIL home page