(data stored in ACNUC7421 zone)

EMBL: CP000094.PE399

CP000094.PE399       Location/Qualifiers
FT   CDS_pept        456326..456544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0401"
FT                   /product="50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72145"
FT                   /db_xref="GOA:Q3KJB1"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJB1"
FT                   /protein_id="ABA72145.1"
FT                   /translation="MKADIHPNYPEVAVTCSCGNKFETRSTFGKALAIDVCNECHPFYT
FT                   GKQKTLDTGGRVQKFADRFGAFGAKKA"
     atgaaagccg atatccaccc gaattaccca gaagttgcag taacttgcag ctgcggcaac        60
     aagttcgaaa cccgttcgac cttcggcaaa gccctggcga tcgacgtttg caacgagtgc       120
     cacccgttct acaccggtaa gcagaagact ctggacaccg gtggtcgcgt tcagaagttc       180
     gccgaccgtt tcggtgcttt cggcgcgaaa aaggcctaa                              219
//

If you have problems or comments...

PBIL Back to PBIL home page