(data stored in ACNUC7421 zone)

EMBL: CP000094.PE408

CP000094.PE408       Location/Qualifiers
FT   CDS_pept        466551..467069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0410"
FT                   /product="shikimate kinase I"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72154"
FT                   /db_xref="GOA:Q3KJA2"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJA2"
FT                   /protein_id="ABA72154.1"
FT                   /translation="MRNLILVGPMGAGKSTIGRLLAKELRLPFKDSDKEIELRTGANIP
FT                   WIFDKEGEPGFRDREQAMIAELCAFDGVVLATGGGAVMRDANRKALHEGGRVVYLHASV
FT                   EQQVGRTSRDRNRPLLRTANPEKTLRDLLAIRDPLYREIADLVVETDERPPRMVVLDIL
FT                   DRLAQLPPR"
     gtgcgaaatt tgattcttgt aggaccgatg ggggctggaa aaagcaccat cggccgatta        60
     ctggccaaag agctgcgcct gccgttcaag gattccgaca aggaaattga actgcgtacg       120
     ggcgccaata tcccgtggat cttcgacaag gaaggcgagc ccggctttcg tgaccgtgag       180
     caagcgatga tcgccgagct gtgcgcgttc gacggcgtgg tgctggcgac cggcggcggc       240
     gcggtgatgc gcgatgccaa ccgcaaggcc ctgcacgagg gcgggcgggt ggtgtatctg       300
     cacgcctccg tcgagcagca ggtcggacgc acctctcgcg accgcaaccg gccgttgctg       360
     cgcaccgcca atccggagaa aactctgcgc gacctgctgg cgatccgtga tccgctctat       420
     cgggaaatcg ccgatctggt ggtagaaacc gacgagcggc caccgcgcat ggtcgtgctc       480
     gatattctcg accgcctggc gcagcttccg ccccgttaa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page