(data stored in ACNUC7421 zone)

EMBL: CP000094.PE410

CP000094.PE410       Location/Qualifiers
FT   CDS_pept        468333..469934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72156"
FT                   /db_xref="GOA:Q3KJA0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJA0"
FT                   /protein_id="ABA72156.1"
FT                   /translation="MTSLHADEAFLGHFQLSHDPFAPRVPGFKFFPAQRKPVLGQLHHL
FT                   ARYSQLLLVVTGPQGSGKTLLRQALVASTNKQSVQSVVVSARGAGDAAGVLRQIAQALD
FT                   VAQAEVGAILDQVVQLALTGQEVYLLVDDAEQLDESALEALMALGAGAPEGRPHVFLFG
FT                   ESSLIAQLEALHLEEERFHVIELQPYTEEETREYLDQRLEGAGRGVELFTADQISDIHE
FT                   SSEGWPGNINQVARDALIEVMIASRSAVKRPSMGFNMPKKHVLAISAVVVVAVAAAWLM
FT                   PGRNKAPTTGAPANEQAQLPLGQGAPQAGGAPSVEFNGNTQPMPLPLVGNSQPVMRGPL
FT                   AEAAGGITEGDDGVPVEGSSNTPPTVTTTAPPAGVQAGPAPTPVPVPVPAAKPTPAPTQ
FT                   VATAKPAPAAPVAKPAPAPAKPVAAAKPAEKPVTVAKAAGGSWYAGQPTSNYVVQILGT
FT                   SSEATAQNFVKEQGGEYRYFKKVLNGKPLYVITYGNFANRDAAVSAIKALPAKVQAGKP
FT                   WPRTVASVQQELATTR"
     atgactagtt tgcatgccga cgaggcgttc ctcggccatt tccagttaag tcacgaccct        60
     ttcgcgccgc gggtgccggg cttcaaattc ttcccggccc agcgcaagcc ggtgctgggt       120
     cagctgcatc atctggcgcg ttacagccag ttgctgctgg tggtcaccgg cccgcagggt       180
     agcggcaaga ccctgctgcg tcaggcgctg gtggccagca ccaacaagca atcggtgcag       240
     agcgtcgtcg tttccgcccg tggcgcaggc gatgcagccg gtgtgctgcg tcagattgcc       300
     caggcactgg atgtggccca ggccgaagtc ggggcgatcc tcgatcaggt cgtgcagctc       360
     gcgctgaccg gtcaggaagt ctatctgctg gtggacgatg ccgagcagct cgacgagtcc       420
     gcgcttgaag cactgatggc gctgggcgcc ggcgcgccgg aaggtcgccc gcatgtgttc       480
     ctgttcggcg agtcgtcact gatcgcgcag ctcgaggctt tgcaccttga ggaagagcgc       540
     tttcacgtca ttgaactgca gccgtacacc gaagaagaaa cccgcgagta tcttgaccag       600
     cggctcgaag gcgccggccg cggtgtcgaa cttttcaccg cggatcagat ctctgatatt       660
     cacgaaagct ccgagggttg gccgggcaac atcaaccagg ttgctcgcga tgctctgatc       720
     gaagtcatga ttgccagccg ctctgcggtc aagcgtccaa gtatggggtt caacatgccg       780
     aagaaacacg tattggcgat ttccgccgtc gttgtggtcg cggttgctgc cgcctggctg       840
     atgccgggtc gcaacaaggc accgaccacc ggtgcgccgg ccaacgagca ggcgcaactg       900
     cccttgggcc agggtgcgcc gcaagcgggt ggcgcaccgt ccgtcgaatt caacggcaat       960
     acccagccga tgccgctgcc attggtcggc aactcgcagc cggtaatgcg cggtccgctg      1020
     gctgaagccg ctgggggcat cactgaaggc gacgacggcg tgccggtcga aggttccagc      1080
     aacacgccac cgaccgtgac caccaccgcg ccacctgcgg gcgttcaggc cggccctgcg      1140
     ccgacaccgg ttccggttcc agtcccggcg gccaagccga ccccggcgcc gacccaggtc      1200
     gcgaccgcca agcctgctcc ggccgctcca gtggccaaac cagctccggc acctgccaag      1260
     cctgttgccg ccgccaaacc ggccgagaag ccggtcaccg tcgccaaggc cgccggtggc      1320
     agctggtacg ccggtcagcc gaccagcaac tacgtggtgc agatcctcgg taccagctcc      1380
     gaagcgaccg cgcaaaactt cgtcaaggag cagggcggcg agtaccgtta tttcaagaaa      1440
     gtcctcaacg gcaagcctct ctacgtgatc acctacggca acttcgccaa tcgtgatgca      1500
     gccgtttctg ccatcaaggc cttgccagcg aaggttcagg ctggtaaacc ttggcctcgc      1560
     actgtcgcca gcgtccaaca ggaactggca acaactcgct ga                         1602
//

If you have problems or comments...

PBIL Back to PBIL home page