(data stored in ACNUC7421 zone)

EMBL: CP000094.PE414

CP000094.PE414       Location/Qualifiers
FT   CDS_pept        complement(477548..478822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0416"
FT                   /product="putative transport-related membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72160"
FT                   /db_xref="GOA:Q3KJ96"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ96"
FT                   /protein_id="ABA72160.1"
FT                   /translation="MKTAVAPLAHEVPPAAADDVMTELQEIYIEKGTPAFMRTVLALFS
FT                   GGFATFALLYCVQPMMPLLSHEYSINAAQSSLILSVATGMLAFGLLITGPISDRVGRKP
FT                   VMVAALFAAALCTIASSMMPSWHGVLIMRALIGLSLSGLAAVAMTYLSEEIHPQHIGLA
FT                   MGLYIGGNAIGGMSGRLITGVLIDFVSWHTAMMVIGGLALIAAAVFWKILPESRNFRSR
FT                   SLHPRSLLDGFTMHFRDAGLPLLFLEAFVLMGAFVTLFNYIGYRLLAEPYHMDQVFVGL
FT                   LSVVYLSGIYSSAKIGSLADKLGRRKVLWATIALMFAGLALTMFTPLPLVIIGMLIFTF
FT                   GFFGAHSVASSWIGRRALKAKGQASSLYLFSYYAGSSIAGTAGGVFWHMAGWNGIGLFI
FT                   GALLLVALLVALKLAKLPPLGGVKA"
     gtgaaaaccg ccgtcgctcc actggcccat gaagtcccgc ccgctgcggc ggacgatgtg        60
     atgaccgaac tgcaagagat ctacatcgag aaaggcacgc ccgcgttcat gcgcacggtg       120
     ctcgcgctgt tcagcggagg cttcgccacc ttcgccctgc tgtactgcgt gcagccgatg       180
     atgccgctgc tgtcccacga gtattcgatc aacgctgcgc agagcagcct gatcctgtcg       240
     gtggccaccg gcatgctggc gttcggtctg ctgatcaccg gcccgatttc cgatcgggtc       300
     gggcgcaaac cggtgatggt cgccgcgctg tttgctgctg cgctatgcac catcgccagt       360
     tcgatgatgc cgagctggca cggcgtgctg atcatgcgcg cgctgatcgg gctgtcattg       420
     agtggcctgg cggcggtggc gatgacgtac ctgagcgagg aaatccatcc gcagcacatc       480
     gggctggcga tgggtttgta catcggcggc aacgcgattg gcggcatgag cgggcggttg       540
     atcaccggtg tgctgatcga cttcgtcagc tggcacaccg cgatgatggt gatcggtggg       600
     ctcgcgctga ttgcggcggc ggtgttctgg aaaatcctgc cggaatcgcg caacttccgc       660
     tcccgctcgc tgcatccgcg cagcctgctc gacggcttca ccatgcactt tcgcgatgcc       720
     ggcctgccgt tgctgttcct tgaggcgttc gtgctgatgg gcgccttcgt caccctgttc       780
     aactacatcg gttaccgcct gctggccgag ccgtatcaca tggatcaagt gttcgtggga       840
     ctgctgtcgg tggtgtacct gtcgggcatc tacagctcgg cgaaaatcgg ttcgctggcc       900
     gacaaactgg gacgccgcaa agtgctgtgg gccaccatcg ccctgatgtt cgccggcctc       960
     gccctgacca tgttcacacc gctgccgctg gtgatcattg gcatgctgat cttcaccttt      1020
     ggcttcttcg gcgcccactc ggtggccagc agctggatcg gccgccgggc gctcaaggcc      1080
     aagggccagg cgtcgtcgtt gtacctgttc agctattacg ccgggtcgag catcgccggg      1140
     acagcgggcg gggtgttctg gcacatggcc gggtggaacg ggattggcct gttcatcggc      1200
     gcgctgttgc tggtggcgct gttggtggcg ttgaagctgg cgaagctgcc gccgctcggt      1260
     ggcgtcaaag cctga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page