(data stored in ACNUC7421 zone)

EMBL: CP000094.PE418

CP000094.PE418       Location/Qualifiers
FT   CDS_pept        480696..480983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0420"
FT                   /product="putative phage DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72164"
FT                   /db_xref="GOA:Q3KJ92"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ92"
FT                   /protein_id="ABA72164.1"
FT                   /translation="MTEQFTRWDSAEYLKTEEDMANYLDACMEEAGDDPAFIAKALGTI
FT                   ARARGMTQVARDAGLSRESLYRALSGEVNPEFGTILKVMKALGLKLHAST"
     atgaccgaac aattcactcg ttgggactca gccgagtacc tcaagacaga agaggacatg        60
     gccaactatc tggatgcctg catggaagag gcgggggatg acccggcttt tattgccaag       120
     gcacttggca cgattgctcg ggcgcgtggc atgacccagg tcgcgcggga tgcggggcta       180
     tcaagggaaa gtctttatcg cgcactgtca ggcgaggtaa atcctgaatt tggaacgatc       240
     ctcaaagtca tgaaagcgct ggggctgaag ttgcatgcca gcacatga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page