(data stored in ACNUC7421 zone)

EMBL: CP000094.PE419

CP000094.PE419       Location/Qualifiers
FT   CDS_pept        complement(481032..481472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72165"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ91"
FT                   /protein_id="ABA72165.1"
FT                   /translation="MHFKKLAATLLICAMPAVSQARDTAVYLPFDKAVAEATRTGKIDG
FT                   SVKFYLAGNAPAGKVTVVSPGAVTNKKTNAFNKTDQEACEWVVQSAIISLHQAAKNAGA
FT                   NAVTNIVSFYKSNERKDAKTYECHAGAIMAGVALKGDLATVQ"
     atgcacttca agaaactcgc tgccaccctg ctcatctgcg ccatgccggc cgtcagccag        60
     gcccgtgaca cggcggtcta cctgccgttc gacaaggccg tcgccgaagc gacccgcacc       120
     ggcaagatcg acggcagcgt gaagttctat ctggcgggca acgccccggc cggcaaagtc       180
     accgtcgtca gccccggcgc cgtgaccaac aagaagacca acgccttcaa caagaccgac       240
     caggaagcct gcgagtgggt cgtgcaatcg gcgatcatca gcctgcacca ggccgcaaaa       300
     aacgccggcg ccaacgccgt gaccaacatc gtcagcttct acaagagcaa cgagcgcaag       360
     gatgcgaaaa cctacgaatg ccacgcgggc gcgatcatgg ccggcgtagc gttgaagggc       420
     gatctggcga cggttcagta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page