(data stored in ACNUC7421 zone)

EMBL: CP000094.PE42

CP000094.PE42        Location/Qualifiers
FT   CDS_pept        complement(46001..47332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0042"
FT                   /product="proton glutamate symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71786"
FT                   /db_xref="GOA:Q3KKC0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR034703"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKC0"
FT                   /protein_id="ABA71786.1"
FT                   /translation="MKKAKLSLAWQILIGLVLGIAIGALLNHFSAEKAWWISNVLQPAG
FT                   DIFIRLIKMIVIPIVISSLIVGIAGVGDAKKLGRIGLKTIIYFEIVTTIAIVVGLLLAN
FT                   LFHPGAGIDMSTLGTVDISKYQATAAEVQHEHAFIETILNLIPSNIFAAMARGEMLPII
FT                   FFSVLFGLGLSSLQSDLREPLVKMFQGVSESMFKVTHMIMNYAPIGVFALIAVTVANFG
FT                   FASLLPLAKLVILVYVAIAFFAFVILGLIAKMFGFSVIKLMRIFKDELVLAYSTASSET
FT                   VLPRVIEKMEAYGAPKAICSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSISQQL
FT                   LLVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRVMDMARTALNVIG
FT                   NALAVLVIARWEGMYDDAKGQRYWNSLPHWRSKEKLPAGDVSKN"
     atgaagaagg caaagcttag cctcgcctgg cagatcctca tcggtctggt attgggaatt        60
     gcaatcggtg cgttgctcaa ccatttcagt gccgagaagg cctggtggat cagcaatgtc       120
     ctgcaaccgg caggcgatat ctttatccgt ctgatcaaaa tgatcgtgat cccgatcgtt       180
     atctcttccc tgatcgtcgg catcgccggc gtgggcgacg ccaagaagct cgggcgcatc       240
     ggcctgaaga ccatcatcta cttcgaaatc gtcaccacca tcgccatcgt tgtcggcctg       300
     ctgctggcca acctgttcca cccgggtgcc ggcatcgaca tgagcaccct gggcactgtg       360
     gatatctcca agtaccaggc gaccgccgcc gaagtgcagc atgaacacgc gttcatcgag       420
     accatcctca acctgatccc gtcgaacatc ttcgcggcca tggcccgcgg cgagatgctg       480
     ccgatcatct tcttctccgt actgttcggt ctcggtctgt cgagcctgca gtcggacctg       540
     cgcgagccgc tggtaaagat gttccagggc gtctcggaaa gcatgttcaa agtcacccac       600
     atgatcatga actacgcccc gatcggcgta ttcgccctga tcgcggtgac cgtggccaac       660
     ttcggtttcg cctcactgct gccgctggcc aaactggtaa tcctggttta cgtcgccatc       720
     gccttcttcg ccttcgtgat tctcggcctg atcgccaaga tgttcggttt ctcggtgatc       780
     aagctgatgc gcatcttcaa ggatgagttg gtgctggctt actccaccgc ttcctcggaa       840
     accgtgctgc cacgggtgat cgagaagatg gaagcctacg gcgcaccgaa agccatctgc       900
     agtttcgtag tgccgaccgg ctactcgttc aacctcgacg gctcgaccct gtaccagtcc       960
     atcgcggcga ttttcattgc ccagctgtac ggcatcgacc tgtcgatcag ccagcaactg      1020
     ctgctggtcc tgaccctgat ggttacctcc aaaggcatcg ccggcgtacc gggcgtgtcc      1080
     ttcgtggtgc tgctggccac cctgggcagc gtgggtattc cgctggaagg cctggccttc      1140
     atcgccggtg tcgaccgtgt gatggacatg gcgcggaccg ccctgaacgt gatcggcaac      1200
     gccctcgccg tactggtcat cgcccgttgg gaaggcatgt acgacgacgc caagggccag      1260
     cgctactgga actcgctgcc gcattggcgc agcaaggaaa aactgccggc cggtgacgtt      1320
     tcgaaaaact ga                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page