(data stored in ACNUC7421 zone)

EMBL: CP000094.PE420

CP000094.PE420       Location/Qualifiers
FT   CDS_pept        complement(481493..482728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0422"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72166"
FT                   /db_xref="GOA:Q3KJ90"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ90"
FT                   /protein_id="ABA72166.1"
FT                   /translation="MKRVVVTGMAGITSLGSDWDTIAGNFAANRSGIRRMDEWDRFSEL
FT                   NTRLAGPIDDFQVPAHWTRKQLRSMGRVSRLAVGAAEKALADAGLLGDESIKDGRMGVA
FT                   CGSSTGSTDEIKAFGNMLLNSVAEGLNANSYVRMMPHTTAANISIFFGLTGRLIPTSSA
FT                   CTSGSQGIGYAYEAIKFGRLPLMLAGGAEELCPTEAMVFDALYATSLKNDAPHTSPRPY
FT                   DKDRDGLVIGEGGGMLVLEELEHALARGAHIHAEIVGFGSNADGQHTTRPEQITMRRAM
FT                   ELALEDAGLAPDVIGYVNGHGTATEQGDVAETLATSALFGERMPISSQKSFLGHTLGAC
FT                   GALESWFSIEMLNRDLYVHTLNLDEVDPHCGKLDYLRGEFRQMSHDYVMNNNFAFGGVN
FT                   TSLIFRRWPQPN"
     atgaagcgcg tcgtcgtcac cggcatggcc ggcattacct cgctgggcag cgactgggac        60
     accatcgccg gcaatttcgc cgccaaccgc agcggcatcc gccggatgga cgagtgggat       120
     cgcttcagcg agctcaacac gcgcctggcc gggcctatcg atgatttcca ggtgccggcg       180
     cactggactc gcaaacagct gcgcagcatg ggccgtgtct cgcggctggc tgtcggcgcg       240
     gcggaaaaag cgctggccga tgccggcctg ctcggcgacg agtcgatcaa ggacgggcgc       300
     atgggcgtgg cctgtggttc gtccaccggc agcaccgacg aaatcaaggc gttcggcaac       360
     atgctgctca actcggtggc cgagggcctc aacgccaact cctacgtgcg catgatgccg       420
     cacaccacgg cggcgaacat cagcatcttc ttcggcctta ccggccgctt gatcccgacc       480
     tccagcgcct gcaccagtgg cagccagggc atcggttacg cctacgaggc gatcaagttc       540
     ggacgcctac cgctgatgct cgccggcggc gccgaagaac tgtgcccgac ggaagccatg       600
     gtgttcgacg cgctgtacgc caccagcctg aaaaacgatg caccgcacac ctcgccacgc       660
     ccgtacgaca aggaccgcga cggtctggtg atcggtgaag gcggcggcat gctggtactt       720
     gaagaactgg aacatgccct ggcgcgcggt gcgcacattc acgccgagat cgtcggtttc       780
     ggcagcaacg ccgacggcca gcacaccacc cgccccgaac aaatcaccat gcgccgggca       840
     atggaactgg cgctggaaga tgcaggcctt gcgccggacg tcatcggcta cgtcaacggc       900
     cacggcaccg ccaccgaaca gggcgatgtc gctgaaaccc tggccaccag tgccctgttc       960
     ggcgaacgca tgccgatcag ttcgcaaaag agcttcctgg gccacaccct cggcgcctgc      1020
     ggggcgctgg agtcgtggtt cagcatcgag atgctcaacc gcgacctgta cgtgcacacg      1080
     ctcaacctcg acgaggtcga cccgcactgc ggcaaacttg actacctgcg cggcgaattc      1140
     cgccagatga gccacgacta cgtgatgaac aacaacttcg ctttcggcgg ggtcaacacc      1200
     tcgctgattt tccgtcgctg gccccaaccg aattaa                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page