(data stored in ACNUC7421 zone)

EMBL: CP000094.PE422

CP000094.PE422       Location/Qualifiers
FT   CDS_pept        complement(483449..483913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72168"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ88"
FT                   /protein_id="ABA72168.1"
FT                   /translation="MTHWPLAELLPHAGDMILIDRILSFDDEQIHTTLTVRPGGLFSLP
FT                   DGSLPAWVGVELMAQSVAAFAGCHARQKGNPVELGFLLGTRKFECNVAAFPVGSELTIH
FT                   GLRSLEDDNGMGVFECHINAPGIEASARLNVFRPPQAADYLEQSKESNDD"
     atgacccact ggccgctcgc cgaattgctg ccccacgctg gcgacatgat cctgatcgac        60
     cggatcctga gctttgacga cgaacagatc cacaccacgc tcaccgtccg gcccggcggc       120
     ctgttcagcc tgcccgacgg cagcctgccg gcgtgggtcg gcgttgagct gatggcgcaa       180
     agcgtcgccg cgtttgccgg ctgccatgcg cggcagaaag gcaacccggt ggagctgggc       240
     tttctgctcg gcacacgcaa gttcgaatgc aatgtcgcgg cctttccggt tggcagcgaa       300
     ctgaccatcc atggcctgcg ctcgctggaa gacgacaacg gcatgggtgt attcgaatgc       360
     catatcaatg cgcccggcat cgaggccagc gcccggttga acgtgttccg cccgccccag       420
     gcagcggact atctggaaca atccaaggag tcgaacgatg actga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page