(data stored in ACNUC7421 zone)

EMBL: CP000094.PE43

CP000094.PE43        Location/Qualifiers
FT   CDS_pept        complement(48030..48494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71787"
FT                   /db_xref="GOA:Q3KKB9"
FT                   /db_xref="InterPro:IPR014453"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKB9"
FT                   /protein_id="ABA71787.1"
FT                   /translation="MKGLKTLAAALLLGGSAMAMAANDGQARVNELLSSDPQYRETWEG
FT                   VVKKEERLPEWVMNLSGAPDQQMNAVTEDGDQYLVGPLCESQDKCLNHRLIVAFSFDKK
FT                   HAYAMLVDVPEGLPADKSPTRHATYRFLGKPDQGMQDLLMETLKKDPNWY"
     atgaagggtt taaagacatt ggcagccgcc ctgctcctgg gcggtagtgc catggcgatg        60
     gcggccaatg acggccaggc gcgggtcaac gaactgctga gttccgaccc gcaatacagg       120
     gaaacctggg aaggcgtggt gaagaaggaa gaacgcctgc cggaatgggt aatgaacctc       180
     tccggcgcgc cggaccaaca gatgaatgcc gtgactgaag atggcgatca gtatctggtg       240
     gggccgctct gcgaatcgca ggacaaatgc ctcaaccacc gtctgatcgt cgccttcagc       300
     ttcgacaaga aacatgctta cgccatgttg gtcgatgtgc ccgaaggact gccggccgac       360
     aagtcgccaa cgcgacatgc cacctaccgc ttcctcggca agcccgacca gggcatgcag       420
     gatctgttga tggaaacgct gaagaaagat ccgaactggt attga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page