(data stored in ACNUC7421 zone)

EMBL: CP000094.PE430

CP000094.PE430       Location/Qualifiers
FT   CDS_pept        complement(491620..492045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72176"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ80"
FT                   /protein_id="ABA72176.1"
FT                   /translation="MRSAGVLHADTEILVPFFDVDTMHVVWHGHYVKYLEVARCALLDK
FT                   IGHNYNQMVDSGYAWPVIDLQLRYVRGAVFGQRLNVRASLVEWENRLKIHYLITDAQTG
FT                   ERLTRASSVQVAVEVSSREMQLASPKVFTDAVERMLR"
     atgcgtagcg ccggagtgct tcacgccgat acggaaatcc tcgtgccgtt ctttgacgtc        60
     gacaccatgc acgtcgtctg gcacggccat tacgtgaaat acctggaagt ggcgcgttgc       120
     gcgttgctcg acaagatcgg ccacaactac aaccagatgg tcgactcggg ctatgcctgg       180
     ccggtgatcg acctgcaact gcgctacgtg cgcggcgcgg tgttcggtca gcggctgaac       240
     gtgcgcgcca gtctggtgga gtgggaaaac cgcctgaaga ttcactacct gatcaccgat       300
     gcccagaccg gcgaacgcct gacccgcgcc agctcggtgc aggtcgccgt cgaagtcagc       360
     agccgcgaga tgcaactggc ttcgccgaaa gtcttcaccg atgccgtgga aaggatgctg       420
     cgatga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page