(data stored in ACNUC7421 zone)

EMBL: CP000094.PE435

CP000094.PE435       Location/Qualifiers
FT   CDS_pept        complement(496910..497455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0437"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72181"
FT                   /db_xref="GOA:Q3KJ75"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ75"
FT                   /protein_id="ABA72181.1"
FT                   /translation="MSRLIGLGLLLAGLLYPFAVYFGMEHFAPWQFGLLLGGLWLARAL
FT                   TGERKPGSLWMAFVAIVFCLLLAVFDSPLLLRWYPVLISGFMLVLFSLSLKYGPPMVER
FT                   LARLREPQLPPKAIRYTRQVTVAWSVFFFCNGLCAALLTLWAPLNWWMLYTGLISYGLI
FT                   GLMFAIEWLIRQRVRGRP"
     atgagccgac tgatcggtct cggcctgctg ctggcgggcc tgctgtatcc ctttgcggtg        60
     tatttcggca tggagcattt cgcgccatgg cagttcggcc tgctgctggg cggcctgtgg       120
     ctggcccgcg cgctgaccgg cgaacgcaag cccggcagcc tgtggatggc ctttgtggcg       180
     atcgtgttct gcctgctgct ggcggtgttc gacagccctt tgctgctgcg ttggtacccg       240
     gtgctgatca gcggcttcat gctggtgctg ttcagcctga gcctgaaata cggcccgccg       300
     atggtcgagc gtctggctcg cctgcgtgag ccgcaactgc cgcccaaggc gattcgttac       360
     acccgccagg tcaccgtggc ctggagcgtg tttttctttt gcaacggttt gtgcgccgcc       420
     ctgctgacac tgtgggcgcc gctgaactgg tggatgttgt acaccggcct gatctcctac       480
     ggattgatcg gcctgatgtt tgccattgaa tggctgatac gacaacgggt aagaggtcgc       540
     ccatga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page