(data stored in ACNUC7421 zone)

EMBL: CP000094.PE436

CP000094.PE436       Location/Qualifiers
FT   CDS_pept        complement(497452..497706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0438"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72182"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ74"
FT                   /protein_id="ABA72182.1"
FT                   /translation="MQTRDDIFNTLRDALVELFELDPARVSLESNLYQDLEIDSIDAVD
FT                   LIDHIKRQTGKKIAAEEFKSVRTVSDVVEAVYRLVQPAA"
     atgcaaactc gtgacgacat cttcaacacc ctgcgcgatg ccctggtcga gttgttcgaa        60
     ctggacccgg cccgcgtgag cctggaatcc aacctgtatc aggatctgga aatcgacagc       120
     atcgacgccg tcgacctgat cgatcacatc aagcgccaga ccggcaagaa aatcgccgcc       180
     gaggagttca agtcggtgcg caccgtcagc gacgtggtcg aggcggtcta ccgtctggtt       240
     caaccggcgg catga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page