(data stored in ACNUC7421 zone)

EMBL: CP000094.PE437

CP000094.PE437       Location/Qualifiers
FT   CDS_pept        complement(497716..497976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0439"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72183"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ73"
FT                   /protein_id="ABA72183.1"
FT                   /translation="MSDLNRDIKELIIDALGLEDISAEDIGDDQTLFGEGLGLDSVDAL
FT                   ELGLAIQKKYGIKIDADAKDTRNHFSNVASLAAFVTAKQAA"
     atgagcgatc taaaccgtga catcaaagag ctgatcatcg acgccctggg cctcgaagac        60
     atcagcgcag aggacatcgg cgacgaccag acgctgtttg gcgaaggcct gggcctggat       120
     tccgtcgacg ctctggaact tggcctggcg atccagaaaa agtacggcat caaaatcgac       180
     gccgacgcca aggacacccg caaccatttc tccaacgtgg cgagccttgc ggcgttcgtc       240
     acggcaaaac aggcagcttg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page