(data stored in ACNUC7421 zone)

EMBL: CP000094.PE439

CP000094.PE439       Location/Qualifiers
FT   CDS_pept        complement(498742..499467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72185"
FT                   /db_xref="GOA:Q3KJ71"
FT                   /db_xref="InterPro:IPR002088"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ71"
FT                   /protein_id="ABA72185.1"
FT                   /translation="MSVINFNIAQWRAWAPGLDSVEAWQAWSRQPVVLESSDAAPDVSF
FT                   LPAMQRRRLSRLARMAFSVGWPLADGRENLPLVFVSRHGETPRTFEILSDLANDQPLSP
FT                   TQFSLSVHNAIIGLWSIMRGETSEMTALAAAGDGLEHGMLEAATLLNEGAPAVLLVITE
FT                   EQPPEAYSTWIDDVPFPYAVGLLLTPGTDWRLTLNSAPEARSKTQWPHALNLLRTLLDQ
FT                   QPHCQHAWKNRLWTWQRNP"
     atgtccgtga tcaacttcaa catcgcccaa tggcgcgcct gggctcccgg gctcgacagt        60
     gtggaagcct ggcaagcctg gagccgacaa ccggtcgtgc tcgaaagcag cgatgccgca       120
     cccgatgtgt cgtttctgcc ggccatgcag cgccgtcgtc tcagccgtct ggcgcggatg       180
     gcgttcagtg tcggctggcc gctggccgac ggtcgggaaa atctgccgct ggtgttcgtc       240
     tcccggcacg gcgaaacccc acgcaccttt gaaattctca gcgatctggc caacgatcag       300
     ccgctgtcgc cgacccagtt cagcctgtcg gtgcataacg cgatcatcgg cctgtggtcg       360
     atcatgcgcg gcgaaaccag cgaaatgact gccctcgccg cagccggcga cggcctcgaa       420
     cacggcatgc tcgaagcggc gacgttgttg aacgaaggag ccccggcagt gctgctggtg       480
     atcaccgagg aacaaccgcc cgaagcctat tcgacgtgga tcgacgacgt accatttccc       540
     tatgcagtcg ggctgttgct cacccccggt accgactggc ggctgaccct gaacagcgcc       600
     cccgaagcac ggtcaaaaac gcagtggcct catgcgctga atctgctgcg aaccctgctc       660
     gatcagcaac cccattgcca acatgcctgg aagaatcgtc tatggacctg gcaacgcaac       720
     ccgtga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page