(data stored in ACNUC7421 zone)

EMBL: CP000094.PE448

CP000094.PE448       Location/Qualifiers
FT   CDS_pept        510651..512588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0450"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72194"
FT                   /db_xref="GOA:Q3KJ62"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ62"
FT                   /protein_id="ABA72194.1"
FT                   /translation="MQFWRRSIQWQLILGMGTALLVSILIVVGIYTLVVNRLAQSYLVE
FT                   QALPSSIEATRNDIERILVQPLTAAKDIASNTMVRDWLANGEDSAKTAGFAQYLEGIRA
FT                   EHKAFTALIIGTESNHYITEKGLDRTLSRDKPADAWFYSFLDSNQPRTLNIDNDGATGE
FT                   LALFIDLKVEQAGKVVGVAGLGLSMKELSELIHNFSFGERGKVYLVRSDGLIQVHPEAQ
FT                   FSGKRTLSEQIGVSAAQAVMGHKVAANSSFQRDGEDFLAFSLPLRDLGWTLVAEVPRSQ
FT                   IYAEARRAMWMSSGIGLVVALVCLALVIWLAQGLVRPIRQVTAALVAIGSGGGDLTHRL
FT                   DSSRADELGDLARGFNRFLDSQRGMIGEVLTTSVRLRVAVGQVARVVDNTAERSGRQQE
FT                   MTDMVATAVHEMGLTVQEIAQNAGNAALASQTARDEAMQAREVVGGSIRHIESMSDEIG
FT                   VAAGAVGELAHQVASIDQVLAVIRGVSEQTNLLALNAAIEAARAGDMGRGFAVVADEVR
FT                   TLARRTQASTDEIQQMIGSLKQGAENAVSSMRTGQAATGTGVESSQRTGASLTAITGQV
FT                   ERISDMNHQVATATEEQSAVTEEINRNVQGISDLARATAGEVRACREDCQMLQRLADDL
FT                   ARQMGGFKLS"
     atgcagttct ggcgtcgcag tattcaatgg cagttgatcc tcggcatggg caccgccctg        60
     ctggtcagca ttctgatcgt ggttggcatt tataccctgg tggtcaaccg cctcgcccag       120
     agctatctgg tcgaacaggc gctgccgtcg agcatcgaag cgacgcgcaa cgacatcgaa       180
     cgaatcctcg ttcaacccct caccgccgcc aaggatatcg ccagcaacac catggtccgc       240
     gactggctgg ccaatggtga ggactccgcc aaaaccgcgg gtttcgcgca gtatctggaa       300
     ggcatccgcg ccgaacacaa ggcttttact gctttgatca tcggcaccga atccaatcac       360
     tacatcaccg aaaaaggcct ggatcgcacc ctcagtcgcg acaaaccggc cgatgcgtgg       420
     ttctactcct tcctcgacag caatcagccg cgaaccttga acatcgacaa cgacggggcc       480
     accggagagc tggcgctgtt catcgatttg aaggtggagc aggccggcaa agtggtcggt       540
     gtcgcggggc tcgggctgag catgaaagag ctgtcggagc tgattcacaa cttcagcttc       600
     ggcgagcgcg ggaaggtcta tctcgtgcgt tccgacggtc ttatccaggt ccatcccgag       660
     gcacagttca gcggcaagcg caccttgagc gagcagatcg gcgtctcggc agcacaagcg       720
     gtcatgggcc ataaagtcgc cgccaacagc agctttcagc gcgacggcga agatttcctc       780
     gccttcagcc tgcctttgcg cgatctcggc tggaccctgg tggccgaagt gccacggtcg       840
     cagatctacg ccgaagcccg ccgggcgatg tggatgagca gcggcatcgg cctggtggtg       900
     gcgctggttt gcctggcgct ggtgatctgg ctggcccagg gcttggtgcg accgattcgt       960
     caggtaacag ctgcattggt agcaatcggt agcggtggtg gagatttgac tcatcggtta      1020
     gattccagcc gcgccgatga actgggcgac ctcgcccggg gcttcaaccg tttcctcgac      1080
     agccagcgcg ggatgatcgg cgaagtgctg accaccagcg tgcgtctgcg cgttgccgtg      1140
     ggccaggtgg ccagggttgt ggataacacc gccgagcgct ccggccgcca gcaggaaatg      1200
     accgacatgg ttgccaccgc cgtccacgaa atgggcctga ccgtgcagga aatcgcccag      1260
     aacgccggta atgcggcact cgcctcgcaa accgcccgcg atgaagcgat gcaggcgcgg      1320
     gaagtggtcg gcggctcgat tcgccatata gaaagcatgt ccgatgaaat tggcgtcgcg      1380
     gcgggcgcgg tgggtgagct ggcgcatcaa gtggcgtcga tcgatcaggt gctggcggtg      1440
     attcgcgggg tgtccgagca gaccaacctg ctggcgttga acgctgccat cgaggctgct      1500
     cgagccggcg atatggggcg tggttttgca gtggtggccg acgaggtgcg gacattggcg      1560
     cgccggactc aggcgtctac cgacgagatt cagcagatga tcggcagcct taaacagggc      1620
     gcggagaatg cggtgtcatc gatgcgcacc gggcaggccg cgacgggtac cggagtcgaa      1680
     tcgagccagc gtaccggggc gtctttgacg gcgattaccg ggcaggtcga gcgcatcagc      1740
     gacatgaacc atcaggtggc gacagcgact gaggagcagt cggcggtgac cgaggagatc      1800
     aaccgcaacg tacagggcat ttccgatctg gcccgggcga cggcggggga ggttcgggcg      1860
     tgtcgtgagg attgtcagat gttgcagcgg ctggcggatg atctggcgcg gcagatgggt      1920
     gggttcaagt tgagctga                                                    1938
//

If you have problems or comments...

PBIL Back to PBIL home page