(data stored in ACNUC7421 zone)

EMBL: CP000094.PE452

CP000094.PE452       Location/Qualifiers
FT   CDS_pept        520721..522736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72198"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ58"
FT                   /protein_id="ABA72198.1"
FT                   /translation="MFAPANQPRFTLTVEGAQFDLKVLEFTGKEAISQPFRFDLELVSE
FT                   RPDLDLESLLHCQAFLSFDEEGSGIHGQIYRVGQGDSGKRLTRYHVSLVPRLAYLGHRI
FT                   NQRIFQHQSVPQIVTQILKDHAILRDAFAFRLGSDYPPREYCVQYAESDLAFIQRLCAE
FT                   VGIHFHFQHSPDGHLLVFGDDQTVFPRLTEPTLYLPGSGMAASAPAIKRFTVRVETRTS
FT                   VVTRRDYDFTKPRLALQSRAESEQRPVLEDYHFPGQFTERETGKQLAQRTLERHVADYR
FT                   QAEGRSDQSALVSGHFLQLTEHPRQDLNDLWLLTAIEHRGRQPQVLEESVTSDGDDFQG
FT                   YRNTFFATPWDVFFRPPLGPEKPRMLGYQPAVVTGPQDSEIHCDEYGRVKVQLAWDRDG
FT                   ELNEHSSCWLRVASGWAHDRYGSVLIPRVGMEVLVGFIDSDADKPLVMGCLPNAATPVP
FT                   LELPADKTRSIFRSQSSPGGGGYNELRIEDRKGAEEIYLRAQRNWTQHVLNDQQVQVDN
FT                   QRSVVVTGLAKHELKADEQHITHGQRQTEVKQDDHLTVTGDRHIRVSNQAINASAQFHV
FT                   SAGQQVVIDGGASATIQAGGQWINIGPGGIFSSVPIVVGGAPMAAISAAPTVPGLPEKL
FT                   AAAPAAILTAAQIMSLKGDAPFCEECERCKGGVCAA"
     atgttcgcgc ctgccaatca accgcgtttc acgttgaccg tcgaaggcgc ccagtttgac        60
     ctcaaagtcc ttgagttcac gggcaaggaa gccatcagcc aaccctttcg ctttgacctg       120
     gagctggtca gtgaacggcc ggatctggat ctggaaagcc tgctgcactg tcaggctttt       180
     ctgagttttg atgaagaagg ttccggtatc cacggtcaga tctatcgggt cgggcagggg       240
     gattccggca agcgtctgac ccgctatcac gtcagcctcg ttccgcgtct ggcctacctg       300
     ggtcatcgga tcaatcagcg aatcttccaa catcaaagcg tgccgcagat cgtgacgcag       360
     atcctcaagg atcacgcgat cctacgcgat gccttcgcgt ttcgcctcgg cagcgattac       420
     ccgccccgtg aatattgtgt gcagtacgcc gaaagcgatt tggcgttcat ccagcgcctg       480
     tgtgccgaag tcggtattca ttttcacttt cagcacagcc cggacggaca tctgttggtg       540
     ttcggcgacg atcagacggt attcccgcgt ctgaccgagc cgacgctgta cctgccggga       600
     agcggcatgg ctgcatcggc gccggcgatc aagcgtttca ccgtacgcgt tgagacccgc       660
     accagcgtgg tcacccggcg tgattacgac ttcaccaagc cccggctggc gctgcaaagt       720
     cgcgccgaaa gcgagcagcg cccggtgctg gaggattacc actttcccgg ccagttcacc       780
     gagcgcgaaa ccggcaagca actggcccag cgcacccttg aacgacatgt cgccgactac       840
     cgtcaggccg agggccgcag cgatcaatcc gctctcgtca gcggacattt cctgcaactg       900
     accgagcatc cgcgccagga tctgaatgac ctctggctgc tgactgcgat cgagcaccgt       960
     ggccgacagc cgcaagtgct ggaggaatcg gtgaccagcg acggtgatga cttccagggc      1020
     taccgaaata cctttttcgc cacgccgtgg gacgtgttct tccgcccgcc gctgggcccg      1080
     gaaaaaccac ggatgctcgg ctatcaaccg gccgtggtca ccggcccgca agacagtgaa      1140
     atccattgcg acgagtacgg tcgggtcaag gtgcaactgg cctgggatcg cgacggtgaa      1200
     ctcaacgagc attccagttg ctggctgcgg gtcgccagcg gctgggccca tgatcgttat      1260
     ggcagcgtgc tgatcccccg agtcggcatg gaagtgctgg tgggtttcat cgattccgac      1320
     gccgacaaac cgctggtcat gggttgcctg ccgaacgccg ccacgccggt tccgctggag      1380
     ctgccggccg acaagacccg cagcattttc cgcagccaga gtagtcccgg cggtgggggc      1440
     tacaacgaat tgcgtatcga agatcgcaaa ggtgccgagg aaatctacct gcgcgcccag      1500
     cgaaactgga cccagcacgt attgaacgat cagcaggtgc aggtggataa ccagcgcagc      1560
     gttgtcgtca ctggtctcgc taaacacgaa ctgaaggccg atgagcagca catcacccac      1620
     ggccagcgcc agactgaagt gaagcaggac gaccacctca cggtgaccgg cgaccggcac      1680
     attcgcgtga gcaatcaggc gatcaacgcc agtgctcaat tccacgtcag cgccggccag      1740
     caggtggtga tcgacggcgg ggcgagcgca acgattcagg cgggcgggca gtggatcaac      1800
     atcggccccg gcgggatctt cagcagcgtg ccgattgtgg tgggtggtgc gccgatggcg      1860
     gcgataagtg cggcgccgac ggtgccgggg ttgccggaaa aactggcggc agccccggct      1920
     gcgattctga ctgctgcgca aatcatgagc ctgaaaggtg atgcgccttt ctgtgaagaa      1980
     tgcgagcgct gcaaaggtgg tgtctgtgca gcctga                                2016
//

If you have problems or comments...

PBIL Back to PBIL home page