(data stored in ACNUC7421 zone)

EMBL: CP000094.PE453

CP000094.PE453       Location/Qualifiers
FT   CDS_pept        522753..523433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72199"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ57"
FT                   /protein_id="ABA72199.1"
FT                   /translation="MPLKPSEQLFAIFSSASAAEPLKAWPLKAQMPKPVWAETIYAEWD
FT                   AVMPYVGIVDAGSEFLDWVATTESRDWGWLAVSSAGLEAVVEHFRSLTQVLMPDGKAVF
FT                   FRFWDGRFLLPILESSEVDAGQLLPVLTRGLINGQTVEIGGRARVSGREFPWWSVPEKL
FT                   LAQFGDDARINNALQWLSEEQPALFEAFPADVLRCKVVRFFAVSASDESSASALLDYLR
FT                   DESE"
     gtgccgctga agccgtcgga gcagttgttc gcgattttca gtagcgccag tgcggcggag        60
     ccgctgaagg cctggccgct gaaagcgcag atgccgaaac cggtctgggc ggaaacgatc       120
     tatgccgagt gggacgcggt gatgccctac gtgggaatcg tcgacgcggg cagtgagttt       180
     ctggattggg tggcgaccac ggagtctcgg gactggggct ggctggcggt ttcttcggcg       240
     gggcttgaag cggtggtcga gcactttcgc agtttgactc aggtgctgat gccggacggg       300
     aaagcggtgt ttttccggtt ctgggatggg cggtttttgt tgccgatcct tgagtcgtcc       360
     gaggtggatg ccgggcaact actaccggtc ctcacgcgag gcttgatcaa tggtcagacc       420
     gtcgagatcg ggggcagggc gcgggtctcg ggtcgggagt ttccttggtg gtcggtgccg       480
     gaaaagctgc tggcgcaatt cggcgatgat gcccggatca acaacgcctt gcagtggttg       540
     agcgaggagc agccggcgtt gttcgaagcg ttccccgccg atgtcttgcg ctgcaaggtt       600
     gtcaggtttt ttgcggtttc ggcgtcggac gaatcgtcgg cttcggcatt gctggactac       660
     ttgcgggacg agtcagagtg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page