(data stored in ACNUC7421 zone)

EMBL: CP000094.PE455

CP000094.PE455       Location/Qualifiers
FT   CDS_pept        complement(524384..524797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72201"
FT                   /db_xref="InterPro:IPR032032"
FT                   /db_xref="InterPro:IPR038314"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ55"
FT                   /protein_id="ABA72201.1"
FT                   /translation="MRRPIISLLCLLSSYQIVASEGRTEQARQNLKNYGLSHCILAPFK
FT                   EHSAMKKDIELSAGAYSFMGKGLHTIVQNEDTLEVTHDPYAETEKHMADAYLKTSSTSK
FT                   QAGKNIVFYSCLEIYNSPEFDAFIKSQDRYLQN"
     atgcgtcgcc cgatcatctc tctattgtgc ctgctcagct cataccaaat cgttgccagc        60
     gaaggccgta ctgaacaagc tcgtcagaac ctcaagaact acggcctgag ccactgcatc       120
     ctggcgccat tcaaagagca ttccgcaatg aaaaaggaca ttgaactgtc cgccggagcc       180
     tactcgttca tgggcaaagg cctgcacacc attgttcaga atgaggacac gctggaggtc       240
     acgcatgatc cgtatgccga gacagagaaa cacatggcag acgcctacct caaaacatcc       300
     tcgaccagca aacaggctgg taaaaacata gttttctatt cttgtctgga aatttataac       360
     tccccggaat ttgacgcttt catcaagtcg caggatcggt atctgcaaaa ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page