(data stored in ACNUC7421 zone)

EMBL: CP000094.PE458

CP000094.PE458       Location/Qualifiers
FT   CDS_pept        complement(526838..529534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0460"
FT                   /product="conserved GGDEF/EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72204"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ52"
FT                   /protein_id="ABA72204.1"
FT                   /translation="MKSQPDAASRMVAEVVTQLPVPSRLGMLRFERLNEASWAMLFLDP
FT                   NCERQFGQPAVELCALVGSPYASLMEPEARYQLHDAIQQQLGQSPHYLVRYTLHTAAGA
FT                   LSILELGEAYKQHNRHLLRGYLLAVDNVFDETPSLPSVDLETQNSRLQIALELNQRAQQ
FT                   EQLQHLERVRAQQDLILLLARQRYSSQNSLQEAAELITRCACDIYEIDCASLWNLEGQK
FT                   LVPISAYHRATQEYILPDVIDVSGFPDYMDALHGSRAIDAHNAMRDPRTREMAEALRPR
FT                   DVNAMLDASIRVDGQVVGVLCLEQTGVTRAWQSDEIAFAGELADQFAQVINNHNRRTAT
FT                   SALHLFQRAVEQSANAFLLVNCDGVVEYVNPSFTAITQYTTEEVHGQRLSELPALENLS
FT                   ELLFDAPSALAKSNSWQGEFKSRRKNLEPYWGQLSISKVYGDNRELTHYIGIYEDITQT
FT                   KLAQQRIERLAYTDNLTNLGNRPAFIRNLDERFARDSDTPISLLLVDIDNFKRINDSLG
FT                   HQTGDKLLISLARRLRNSLSPSGSLARFASNEFAVLLDDTDLATGQQIANQLLATLDKP
FT                   MFVDNQLISVTGSVGLACAPLHGRDPQTLMRNAGLALHKAKANGKHQVQVFTEALNAEA
FT                   SYKLFVENNLRRALTQNELDVFYQPKLCLRSGRLLGMEALLRWNHPERGMIRPDQFISV
FT                   AEETGLIIPIGKWIARQACRMSKALTAAGMGNLQVAINLSPKQFSDPDLVASIANILKE
FT                   EALPANLLELELTEGLLLEATEDTHLQLDQLKRLGLTLAMDDFGTGYSSLSYLKKFPID
FT                   IIKIDRSFIHEIPDNQDDMEITSAVIAMAHNLKLKVVAEGIETAEQLAFLRRHRCDVGQ
FT                   GYLFDRPIPGGELIQALKRYPRGPLSL"
     atgaagagcc aacccgatgc cgccagccgt atggtggccg aggtagtgac gcagttgcct        60
     gtgccctcgc ggctcggcat gctgcgtttc gagcgcttga atgaagccag ttgggccatg       120
     ttgtttctcg atcccaactg tgaacgccag ttcggccagc ccgccgtcga actttgcgcc       180
     ttggtcggct cgccctacgc cagcctgatg gagcccgaag cgcgctatca gttgcatgac       240
     gcaatccagc aacaactcgg ccaaagcccg cattacctgg tgcgctatac cctgcacacc       300
     gccgccggcg cgctgagcat tcttgaactg ggcgaagcct acaaacagca caaccgccac       360
     ttgctgcgcg gttacttgct ggcggtcgac aatgtgttcg acgagacacc ttcgctgccg       420
     tccgtcgacc ttgaaaccca gaattcacgc ctgcaaatcg cccttgagct caatcagcgt       480
     gcccagcagg aacaactgca gcatctggaa cgggtgcgag cccaacagga cctgatcctg       540
     ttgctggccc gccagcgcta cagcagccag aactccctgc aggaagcggc cgagctgatc       600
     acccgctgcg cttgcgatat ctacgaaatc gactgtgcca gcctgtggaa cctcgaaggc       660
     cagaagctgg tgccaatctc ggcgtatcac cgcgccaccc aggaatacat tctgccggac       720
     gtgatcgacg tcagcggctt ccccgattac atggacgcgc tgcacggtag ccgcgccatc       780
     gacgcgcaca acgcaatgcg cgacccgcgt acccgggaaa tggccgaagc cctgcgcccg       840
     cgtgacgtta acgccatgct cgacgccagc atccgcgtcg acggccaggt ggtcggcgtg       900
     ttgtgcctgg agcagaccgg tgtcacccgc gcctggcagt ccgacgaaat cgcctttgcc       960
     ggtgaactgg ccgaccagtt cgcccaggtc atcaacaacc acaatcgccg caccgccacc      1020
     agcgccctgc acctgttcca gcgcgcggtc gagcaaagcg ccaacgcctt cctgctggtc      1080
     aattgcgacg gcgtggtcga gtacgtcaat ccgagcttca cggcgatcac ccagtacacc      1140
     actgaggaag tccacggcca gcgcctgtcg gagctgccgg ccctggaaaa cctcagcgag      1200
     ctgctgttcg acgcgccctc ggcgctggcc aaaagcaata gctggcaggg cgaattcaaa      1260
     agccgccgga aaaacctcga accctactgg ggccagttgt cgatttccaa ggtctacggt      1320
     gacaaccgtg agctgacgca ttacatcggc atttacgaag acatcaccca gaccaaactg      1380
     gcgcagcagc gcatcgagcg cctggcctac accgacaacc tgaccaacct cggcaaccgg      1440
     cctgcattta tccgcaacct ggatgaacgc ttcgcccgtg acagcgatac cccgatcagc      1500
     ctgctgctgg tggacatcga caacttcaag cggatcaacg acagcctcgg ccaccagacc      1560
     ggtgacaagc tgttgatcag cctggcccgg cgcctgcgca acagcctgag ccccagcggc      1620
     agcctggcgc ggttcgccag taatgaattc gcggtgttgc tcgacgacac tgaccttgcc      1680
     accgggcagc agatcgccaa tcaattgctg gcgacgctgg ataaaccgat gttcgtcgac      1740
     aaccagctga tcagcgtcac cggctccgtg ggcctggcct gcgcgccgct gcacggccgc      1800
     gacccacaga ccctgatgcg caacgccggc ctcgctctgc acaaggccaa ggccaacggc      1860
     aaacatcagg tccaggtgtt caccgaagcg ctgaacgccg aggccagcta caaactgttc      1920
     gtcgagaaca acctgcgccg cgccctgacc cagaacgagc tggacgtgtt ctatcagccg      1980
     aagctgtgcc tgcgcagcgg ccgattgctg ggcatggaag cgcttctgcg ctggaatcac      2040
     ccggagcgcg gcatgatccg cccggatcag ttcatcagcg tcgccgagga aaccggcctg      2100
     atcatcccga tcggcaagtg gatcgcccgc caggcctgcc gcatgagcaa ggcgctgacc      2160
     gccgccggca tgggcaatct gcaagtggcg atcaacctgt cgcccaagca gttttccgac      2220
     ccggatctgg tggcctcgat cgccaacatc ctcaaggaag aagcgctgcc ggccaatctg      2280
     ctggaactgg aactgaccga aggcctgctg ctggaagcca ccgaagacac ccacttgcag      2340
     ctcgaccagc tcaagcgtct gggcctgacc ctggccatgg acgacttcgg aaccggttac      2400
     tcgtcgctca gctacctgaa aaaattcccg atcgacatca tcaagatcga tcgcagcttc      2460
     atccacgaaa tcccggacaa ccaggacgac atggaaatca cctccgccgt gatcgccatg      2520
     gcccacaacc tgaaactcaa ggtcgtggcc gaaggcatcg agaccgccga gcaactggcg      2580
     ttcctgcgcc ggcaccgctg cgacgttggc cagggctatc tgttcgaccg gccgattccg      2640
     ggcggcgagc tgatccaggc actcaagcgc tacccgcgtg gcccactctc tctgtaa         2697
//

If you have problems or comments...

PBIL Back to PBIL home page