(data stored in ACNUC7421 zone)

EMBL: CP000094.PE467

CP000094.PE467       Location/Qualifiers
FT   CDS_pept        543464..544198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0469"
FT                   /product="putative lipopolysaccharide core biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72213"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ43"
FT                   /protein_id="ABA72213.1"
FT                   /translation="MAGWNLEPEYSDLAQHFGSLEAVFALQGERLTRDPLSEVIRVQLN
FT                   GVNYYVKRYVGAGKGLRRYLGKPRVKMEWQNLKRFAKWGIPTAEVVAWGLERNGMAYDR
FT                   GAMITRELPRTEDLSALAERNDPKLKDRAWVDGVSRQLAGYTRVMHDHRFTHNDLKWRN
FT                   LLIDDQAQLFLIDCPNGDFWRGFWLKYRITKDLACLDKVAKYHLSNTQRLRFYLQYRQR
FT                   DRLNAADKQRIRHVVRFFEGRE"
     atggcgggtt ggaatctgga gcctgaatac agcgatcttg cacaacactt cggtagcctc        60
     gaagcggtat tcgcccttca gggcgagcgc ctgacccgcg atcctttgtc cgaagtcatt       120
     cgcgtgcagc tcaatggcgt caattattac gtcaagcgct acgtcggcgc cggcaaaggc       180
     ttgcggcgtt atctgggcaa gccccgggtg aagatggaat ggcagaacct caagcgcttc       240
     gccaagtggg gcattcccac cgccgaagtg gtggcgtggg gcctggagcg caacggcatg       300
     gcctacgatc gcggggcgat gatcacccgt gagctgccgc gcaccgaaga cctgtcggca       360
     ctggccgaac gcaacgatcc caagctcaag gatcgcgcct gggtcgacgg cgtcagccgg       420
     cagttggccg gttacacccg ggtcatgcac gaccaccgct ttacccataa cgatctgaag       480
     tggcgcaacc tgctgatcga cgatcaggcg cagctgtttc tgatcgactg cccgaacggc       540
     gatttctggc gtggcttctg gctcaagtac cggatcacca aggatctggc ctgcctcgac       600
     aaggtggcca agtatcacct gtcgaacacc cagcgcctgc gcttctacct gcaataccgc       660
     cagcgtgacc ggctgaatgc cgccgacaag caacggattc gccacgtggt gagatttttc       720
     gagggacgcg aatga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page